DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and Pdik1l

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001101454.1 Gene:Pdik1l / 313609 RGDID:1307476 Length:341 Species:Rattus norvegicus


Alignment Length:370 Identity:97/370 - (26%)
Similarity:154/370 - (41%) Gaps:99/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVALLDCKES 79
            :|.|::.|||:...||....||:|.|........:..| :|...|..: :..|.||:.|.:|...
  Rat    14 VGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELAL-REFWALSSI-KSQHPNVIHLEECILQ 76

  Fly    80 QDCV-------------------SL----------------VMEYCNGGDLADY-LSVKGTLSED 108
            :|.:                   ||                ||::|:|||:.:| ||.|.....:
  Rat    77 KDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTN 141

  Fly   109 TVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEG-- 171
            |  .|::||:.|:..|:...|:||||||.|||:|.:...|  :..:.|||:||||.::..:..  
  Rat   142 T--SFMLQLSSALAFLHKNQIIHRDLKPDNILISQSRLDT--SDLEPTLKVADFGLSKVCSASGQ 202

  Fly   172 ----------AMAATLCGSPMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNE-L 225
                      ...:|.||:..|||||| ....|.:|||:::||.|::..|........:|..| |
  Rat   203 NPEEPVSVNKCFLSTACGTDFYMAPEV-WEGHYTAKADIFALGIIIWAMLERITFIDTETKKELL 266

  Fly   226 KSYYEQNANLAPKIPSGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQGKKAAVSPGEPSQAA 290
            .||.:|...:.|...:.:.....:||:.:.:::...|:..   .:...|              ||
  Rat   267 GSYVKQGTEIVPVGEALLENPKMELLIPVKKKSMNGRMKQ---LIKEML--------------AA 314

  Fly   291 NLRRRVSKSGVLPVDMPPLGGTPPAKAKSPLQQQLEQELKLVKLA 335
            |           |.|.|               ...|.||:||::|
  Rat   315 N-----------PQDRP---------------DAFELELRLVQIA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 84/307 (27%)
STKc_ULK1_2-like 15..273 CDD:271022 84/306 (27%)
DUF3543 638..844 CDD:288883
Pdik1lNP_001101454.1 STKc_PDIK1L 7..331 CDD:270879 95/366 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.