DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and ULK3

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005254346.1 Gene:ULK3 / 25989 HGNCID:19703 Length:483 Species:Homo sapiens


Alignment Length:341 Identity:117/341 - (34%)
Similarity:182/341 - (53%) Gaps:43/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VAIKCITKK--GQLKTQNLLGKEIKILKELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLAD 97
            |||||:.||  .:...:||| .||:|||   .:.|.::|.|.|.:...|.:.|:||:|.||||:.
Human    52 VAIKCVAKKSLNKASVENLL-TEIEILK---GIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSR 112

  Fly    98 YLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADF 162
            ::..:..|.|...|:|:.|||.|::.|:.:.|.|.||||||||||     :|..|.   ||:|||
Human   113 FIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLS-----SLEKPH---LKLADF 169

  Fly   163 GFARFLNEGAMAATLCGSPMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKS 227
            |||:.::.......|.|||:|||||::...|||::.||||:|.|:|:.|.|:.||.:::.:||:.
Human   170 GFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEE 234

  Fly   228 YYEQNANLAPKIPSGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQ----------GKKAAV- 281
            ....|..:...:...:|.|.||||..||.|:...|||::.||.|.::.          |:..|: 
Human   235 KIRSNRVIELPLRPLLSRDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGESLGRATALV 299

  Fly   282 -------SPGEPSQAANLRRRVSKSGVLPVDMPPLGGTPPAKAKSPLQQQLEQ------ELKLVK 333
                   ..|:.:.|.:|..:     .|...:|.|.....|:.|..::.::.|      |||.:.
Human   300 VQAVKKDQEGDSAAALSLYCK-----ALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIV 359

  Fly   334 LAEQQQKEREEQEAQE 349
            .:..|...|:...|::
Human   360 SSSNQALLRQGTSARD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 100/240 (42%)
STKc_ULK1_2-like 15..273 CDD:271022 100/239 (42%)
DUF3543 638..844 CDD:288883
ULK3XP_005254346.1 S_TKc 46..281 CDD:214567 100/240 (42%)
STKc_ULK3 46..280 CDD:271023 100/239 (42%)
MIT_2 290..364 CDD:239147 14/78 (18%)
MIT 385..460 CDD:294211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.