DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and T07F12.4

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001368727.1 Gene:T07F12.4 / 180763 WormBaseID:WBGene00020324 Length:329 Species:Caenorhabditis elegans


Alignment Length:279 Identity:101/279 - (36%)
Similarity:152/279 - (54%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EYEY--SSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHE 68
            :|||  |...|:|.|||..|:||..:.....:|||.:.|      .::...|:|::|   ||:.|
 Worm    55 KYEYMDSVDAMIGMGAFGAVFKGSLKDSSNSIAIKRMLK------VHVKESELKMIK---ELNSE 110

  Fly    69 NVVALLD-CKESQDCVSLVMEYCNGGDLADY---LSVKGTLSEDTVRLFLVQLAGAMKALYTKGI 129
            .:|.:|| |........|:||.|: .||..:   :||||.|:....||.|..:|...||||...|
 Worm   111 YLVGVLDICNFDDFFCCLIMELCD-CDLDHHMRNISVKGRLNPSNFRLLLDNIARGYKALYELKI 174

  Fly   130 VHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFL-NEGAMAATLCGSPMYMAPEV----I 189
            ||||:||||||:::.......|.::||    |||.:|.| |||.....:.|:..||||||    :
 Worm   175 VHRDIKPQNILITYTDASKQIACARIT----DFGISRTLDNEGEELCNVAGTFYYMAPEVGANLL 235

  Fly   190 MSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKSYYEQNANL----APKIPSGVSPDLRDL 250
            .:.|||||.|:||:|.::|||:||:.||...:..:| ..|...||.    .|::|..:|.::..:
 Worm   236 KTCQYDSKVDMWSIGCLLYQCVTGEVPFDECSLCKL-FLYVAGANFDAYDPPELPDELSQEVSGI 299

  Fly   251 LLCLLRRNSKDRISYESFF 269
            :..||:.::..|.:...|:
 Worm   300 IQSLLQLDTTQRCTPTQFY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 99/276 (36%)
STKc_ULK1_2-like 15..273 CDD:271022 96/268 (36%)
DUF3543 638..844 CDD:288883
T07F12.4NP_001368727.1 S_TKc 66..316 CDD:214567 95/264 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24348
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.