DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and STK35

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_543026.2 Gene:STK35 / 140901 HGNCID:16254 Length:534 Species:Homo sapiens


Alignment Length:333 Identity:92/333 - (27%)
Similarity:136/333 - (40%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTEL--HHENVV 71
            ||....:|.|::.|||:....:....||:|.|........:..|.:    ...||.|  .|:|||
Human   202 YSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAE----FWALTSLKRRHQNVV 262

  Fly    72 ALLDC---------------KESQDCVSL----------------------VMEYCNGGDLADYL 99
            ...:|               |.||..:.|                      |||:|.||||..|:
Human   263 QFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYV 327

  Fly   100 SVKGTLSE----DTVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIA 160
                 ||.    .|.:.|::||..|:..|:...||||||||.|||::...|..:       ||:|
Human   328 -----LSRRPDPATNKSFMLQLTSAIAFLHKNHIVHRDLKPDNILITERSGTPI-------LKVA 380

  Fly   161 DFGFARFL-------NEGAM-----------AATLCGSPMYMAPEVIMSLQYDSKADLWSLGTIV 207
            |||.::..       .||..           .::.|||..|||||| ....|.:|||:::||.|:
Human   381 DFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDFYMAPEV-WEGHYTAKADIFALGIII 444

  Fly   208 YQCLTGKAPFYAQTPNE-LKSYYEQNANLAP-------------KIP----SGVSPDLRDLLLCL 254
            :..:.......::|..| |.:|.:|...:.|             .||    :.:|..::.||..:
Human   445 WAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHIPQKRRTSMSEGIKQLLKDM 509

  Fly   255 LRRNSKDR 262
            |..|.:||
Human   510 LAANPQDR 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 92/333 (28%)
STKc_ULK1_2-like 15..273 CDD:271022 90/327 (28%)
DUF3543 638..844 CDD:288883
STK35NP_543026.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..176
STKc_PDIK1L 201..529 CDD:270879 92/333 (28%)
S_TKc 202..523 CDD:214567 92/333 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.