DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and pdik1l

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001120253.1 Gene:pdik1l / 100145304 XenbaseID:XB-GENE-919812 Length:130 Species:Xenopus tropicalis


Alignment Length:88 Identity:25/88 - (28%)
Similarity:42/88 - (47%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVALLDCKES 79
            :|.|::.|||:...|:....||:|.|..:.....:..| :|...|..: :..|.||:.|.:|...
 Frog    14 VGRGSYGVVYEALVRRSGQRVAVKKIRCQAPENVELAL-REFWALSSI-QSQHPNVIHLEECVLQ 76

  Fly    80 QDCVSLVMEYCNGGDLADYLSVK 102
            :|  .:|....:|...|.||.|:
 Frog    77 KD--GMVQRMLHGSSSALYLPVR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 25/88 (28%)
STKc_ULK1_2-like 15..273 CDD:271022 25/88 (28%)
DUF3543 638..844 CDD:288883
pdik1lNP_001120253.1 PKc_like 7..>117 CDD:304357 25/88 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.