DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and TRIL

DIOPT Version :10

Sequence 1:NP_648600.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_055632.2 Gene:TRIL / 9865 HGNCID:22200 Length:811 Species:Homo sapiens


Alignment Length:223 Identity:63/223 - (28%)
Similarity:93/223 - (41%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EPSCPRNCLCLEDFKFVQCANAHLTHVP----LDMPKTAAIIDLSHNVIAELRPEDFANLSRAVE 150
            ||.||..|.| :..:.:.|.|..|..||    |..|.......|..|.|..:...||..|.:...
Human    24 EPVCPERCDC-QHPQHLLCTNRGLRVVPKTSSLPSPHDVLTYSLGGNFITNITAFDFHRLGQLRR 87

  Fly   151 INLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFL 215
            ::|.:|.|.|:....|:...||:.|.|.||.|..:.|.|.|..::|.:|..:.|.|::...|||.
Human    88 LDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANGNEISRLSRGSFE 152

  Fly   216 NQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQ 280
            ....||:......:...||:..|..:..|..|.|..|..: .:...||:.|.|:..|.|...|.|
Human   153 GLESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESNRIR-FLGKNAFAQLGKLRFLNLSANELQ 216

  Fly   281 ----------NIEELCSLLTSIDTISFL 298
                      .:..|.||:.|.:.:..|
Human   217 PSLRHAATFAPLRSLSSLILSANNLQHL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_648600.1 LRR <127..>300 CDD:443914 50/182 (27%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 9/22 (41%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..268 CDD:275380 7/23 (30%)
TRILNP_055632.2 leucine-rich repeat 37..61 CDD:275380 7/23 (30%)
LRR 61..>344 CDD:443914 50/185 (27%)
LRR 1 61..81 5/19 (26%)
leucine-rich repeat 62..84 CDD:275380 6/21 (29%)
LRR 2 84..105 5/20 (25%)
leucine-rich repeat 85..108 CDD:275380 5/22 (23%)
LRR 3 108..129 9/20 (45%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR 4 132..153 7/20 (35%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
LRR 5 156..177 5/20 (25%)
leucine-rich repeat 157..180 CDD:275380 5/22 (23%)
LRR 6 180..201 6/21 (29%)
leucine-rich repeat 181..204 CDD:275380 7/23 (30%)
LRR 7 204..223 5/18 (28%)
leucine-rich repeat 205..254 CDD:275380 9/40 (23%)
LRR 8 230..251 5/15 (33%)
LRR 9 254..275
leucine-rich repeat 255..278 CDD:275380
LRR 10 278..299
leucine-rich repeat 279..302 CDD:275380
LRR 11 302..323
leucine-rich repeat 303..326 CDD:275380
LRR 12 326..347
leucine-rich repeat 327..346 CDD:275380
PCC 332..>401 CDD:188093
leucine-rich repeat 351..363 CDD:275378
PHA03378 <478..>579 CDD:223065
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..549
FN3 589..667 CDD:473895
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.