DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Lrrc17

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_083253.1 Gene:Lrrc17 / 74511 MGIID:1921761 Length:443 Species:Mus musculus


Alignment Length:149 Identity:41/149 - (27%)
Similarity:63/149 - (42%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ETAENRLMPQSSSTSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDM 120
            |..:.:|.|:...:......||..:.....|:|.            ..:.:.|....|..||.::
Mouse   216 EEEKEQLDPKPQVSGIPAVIRPEADSTLCHNYVF------------PIQTLDCKRKELKKVPSNI 268

  Fly   121 PKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKI 185
            |.....:|||.|.|.:|||::|.::....::||:.|.|..||...|.|...|:.|.|:||.|...
Mouse   269 PPDIVKLDLSSNKIRQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLIHLEELDLSNNSLQNF 333

  Fly   186 DPDTFAAAKELTLLDLSNN 204
            |.........|.||.|.:|
Mouse   334 DYGVLEDLYFLKLLWLRDN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 22/55 (40%)
leucine-rich repeat 128..147 CDD:275380 9/18 (50%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
LRR_RI <150..225 CDD:238064 20/55 (36%)
LRR_8 171..254 CDD:290566 12/34 (35%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 5/9 (56%)
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..268 CDD:275380
Lrrc17NP_083253.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..48
leucine-rich repeat 65..83 CDD:275380
LRR 1 84..105
leucine-rich repeat 85..108 CDD:275380
LRR_8 86..143 CDD:290566
LRR_4 107..148 CDD:289563
LRR 2 108..129
leucine-rich repeat 109..132 CDD:275380
LRR 3 132..153
leucine-rich repeat 133..156 CDD:275380
leucine-rich repeat 157..207 CDD:275380
TPKR_C2 165..>201 CDD:301599
leucine-rich repeat 208..245 CDD:275380 5/28 (18%)
leucine-rich repeat 251..271 CDD:275380 5/19 (26%)
LRR_RI <270..352 CDD:238064 28/81 (35%)
LRR 4 271..292 9/20 (45%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
LRR_8 274..330 CDD:290566 22/55 (40%)
LRR 5 295..316 7/20 (35%)
LRR_4 296..334 CDD:289563 14/37 (38%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
LRR 6 319..342 7/22 (32%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.