DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lgi4

DIOPT Version :10

Sequence 1:NP_648600.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001039090.1 Gene:lgi4 / 733906 XenbaseID:XB-GENE-1013883 Length:578 Species:Xenopus tropicalis


Alignment Length:293 Identity:68/293 - (23%)
Similarity:104/293 - (35%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNL 157
            ||..|.|..|  .|.|...  |::|.........:.:.......:.|..|.. |.:::|.|..:.
 Frog    52 CPLGCNCTID--NVLCDGT--TYIPSTFSTDIVSVSIMRCRFPVIPPGSFTP-SMSLQILLFTSC 111

  Fly   158 -ISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDL- 220
             ..:|..|.|||...|:.|.:.|||:..|..:.|.....|..|.|:||.:.....|.||:.|.: 
 Frog   112 SFDAIADDAFQGLRNLEYLFIENNRIKSISRNAFRGLHLLVHLSLANNHLEFLPRGLFLSLPAVK 176

  Fly   221 ---VEFSCVNC--------SWTE-----------LPEQTFQNMSGLEVLRLNKNDFKQQINTKAF 263
               ::.:.::|        .||.           ||.:......|..:..|...|| ..:||...
 Frog   177 HIDLQGNPLHCGCPIKWLMQWTRGVGKNISLRPPLPCEEPAKHRGKSLADLTDKDF-NCVNTSMV 240

  Fly   264 SPLTKIIKLKLPELEQQNIEELCSLLTSI-----DTISFLNYD-----------------ISCYE 306
            ...|    .|||.|..|:.:.|......|     ...:||.:|                 :||..
 Frog   241 RRWT----FKLPSLSVQSFDFLSDHFVVITHPFEGRCTFLEWDHSGHVFRHYDSIKGVSVVSCLP 301

  Fly   307 FVLGTP--------FNGSLIYPTEPPLKGITNP 331
            .|:|..        |.||.:|..:|. .|:.:|
 Frog   302 MVIGDQLFVVVAQLFGGSAVYRLDPS-PGLISP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_648600.1 LRR <127..>300 CDD:443914 47/201 (23%)
leucine-rich repeat 128..147 CDD:275380 2/18 (11%)
leucine-rich repeat 148..171 CDD:275380 7/23 (30%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 5/45 (11%)
leucine-rich repeat 244..268 CDD:275380 5/23 (22%)
lgi4NP_001039090.1 LRR_8 102..161 CDD:404697 19/58 (33%)
leucine-rich repeat 103..126 CDD:275378 7/22 (32%)
leucine-rich repeat 127..150 CDD:275378 7/22 (32%)
leucine-rich repeat 151..174 CDD:275378 8/22 (36%)
PCC 156..>234 CDD:188093 16/78 (21%)
leucine-rich repeat 175..187 CDD:275378 0/11 (0%)
EPTP 285..323 CDD:461033 7/37 (19%)
EPTP 334..377 CDD:461033 68/293 (23%)
EPTP 381..421 CDD:461033
EPTP 534..572 CDD:461033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.