DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lrrc4ca

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001018583.1 Gene:lrrc4ca / 553785 ZFINID:ZDB-GENE-050522-533 Length:647 Species:Danio rerio


Alignment Length:461 Identity:96/461 - (20%)
Similarity:152/461 - (32%) Gaps:138/461 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHN 156
            :||..|.|...|..|.|....|..||..:......::|..|:|..::.:.|.:|.....:.|:.|
Zfish    47 TCPSVCSCSNQFSKVICTRRGLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKN 111

  Fly   157 LISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTI-------------TQ 208
            .|.:|:...|.|...|..|.|.:||||.|....|....:|..|.|.||.|             .:
Zfish   112 HIRNIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRVPSLR 176

  Fly   209 RLD------------GSFLNQPDLVEFSCVNCSWTELP------EQTFQNMSGLEVLRLNKNDFK 255
            |||            |:|....:|...:...|:..|:|      ......|||.::..:....||
Zfish   177 RLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSIIRPGSFK 241

  Fly   256 ---------------QQINTKAFSPLTKIIKLKLP----------------ELEQQN-------- 281
                           |.|...||..|..:::|.|.                .||:.:        
Zfish   242 GLVHLQKLWMMHAQIQTIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHHLERVHLHHNPWNC 306

  Fly   282 ----------IEEL----------CSLLTS--------IDTISFLNYDISCYEFVLGTPFNGSLI 318
                      ::|:          ||..||        :|.    || ..||..|:         
Zfish   307 NCDILWLSWWLKEMVPANTSCCARCSSPTSHKGRYIGELDQ----NY-FHCYAPVI--------- 357

  Fly   319 YPTEPPLKGITNPPIVASITSTAKPVTA----TPAPPRSANRNRGKMDNSTELVKAGILSSET-S 378
              .|||........:.|.:...|..:|:    ||        |...|.:....::..:|:..| :
Zfish   358 --VEPPADLNVTEGMAAELKCRANSLTSVSWITP--------NGSIMTHGAYKIRISVLNDGTLN 412

  Fly   379 TSGVSVEPPAESQTNQVQISQEAINTLLICIMVLAVIGIVIGLICRQDIGGIKTKCCRTSKPEPK 443
            .:.|:::   ::.|....:|..|.||       .|...:.:............|....|:: .|.
Zfish   413 FTNVTMQ---DTGTYTCMVSNSAGNT-------TASATLNVSSTENSSFSYFTTVTVETTE-APP 466

  Fly   444 DQVHPT 449
            |:.|||
Zfish   467 DEGHPT 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 15/55 (27%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 27/99 (27%)
LRR_8 171..254 CDD:290566 27/113 (24%)
leucine-rich repeat 172..195 CDD:275380 9/22 (41%)
leucine-rich repeat 196..219 CDD:275380 11/47 (23%)
leucine-rich repeat 220..243 CDD:275380 5/28 (18%)
leucine-rich repeat 244..268 CDD:275380 7/38 (18%)
lrrc4caNP_001018583.1 LRRNT 48..81 CDD:214470 10/32 (31%)
LRR <78..288 CDD:227223 47/209 (22%)
leucine-rich repeat 79..102 CDD:275380 5/22 (23%)
leucine-rich repeat 103..126 CDD:275380 6/22 (27%)
leucine-rich repeat 127..150 CDD:275380 9/22 (41%)
leucine-rich repeat 151..174 CDD:275380 6/22 (27%)
leucine-rich repeat 175..199 CDD:275380 5/23 (22%)
leucine-rich repeat 200..221 CDD:275380 4/20 (20%)
leucine-rich repeat 222..245 CDD:275380 5/22 (23%)
leucine-rich repeat 246..269 CDD:275380 5/22 (23%)
leucine-rich repeat 270..291 CDD:275380 2/20 (10%)
LRRCT 302..>340 CDD:214507 5/37 (14%)
IG 361..443 CDD:214652 17/99 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.