Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018372.2 | Gene: | lrit2 / 553557 | ZFINID: | ZDB-GENE-050522-160 | Length: | 561 | Species: | Danio rerio |
Alignment Length: | 401 | Identity: | 81/401 - (20%) |
---|---|---|---|
Similarity: | 134/401 - (33%) | Gaps: | 122/401 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 LEPSCPRNCLCLED--FKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEI 151
Fly 152 NLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLN 216
Fly 217 QPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQN 281
Fly 282 IEEL------------------CSLLTSIDTIS-------FLNYDISCY--EFVLGTPFNGSLIY 319
Fly 320 PTEPPLKGITNPPIVASITSTAKP----VTAT---PAPPRSANR--------------------- 356
Fly 357 --------------NRGK--------MDNSTELVKAGILSSETSTSGVSVEPPAESQTN---QVQ 396
Fly 397 ISQEAINTLLI 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 15/55 (27%) |
leucine-rich repeat | 128..147 | CDD:275380 | 3/18 (17%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | <150..225 | CDD:238064 | 20/74 (27%) | ||
LRR_8 | 171..254 | CDD:290566 | 22/82 (27%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 244..268 | CDD:275380 | 5/23 (22%) | ||
lrit2 | NP_001018372.2 | LRR 1 | 55..76 | 4/20 (20%) | |
LRR_8 | 56..114 | CDD:290566 | 15/57 (26%) | ||
leucine-rich repeat | 56..79 | CDD:275378 | 4/22 (18%) | ||
LRR_4 | 78..118 | CDD:289563 | 12/39 (31%) | ||
LRR 2 | 79..102 | 6/22 (27%) | |||
leucine-rich repeat | 80..103 | CDD:275378 | 6/22 (27%) | ||
LRR_8 | 103..162 | CDD:290566 | 22/91 (24%) | ||
LRR_4 | 103..143 | CDD:289563 | 15/63 (24%) | ||
LRR 3 | 103..124 | 7/20 (35%) | |||
leucine-rich repeat | 104..127 | CDD:275378 | 7/22 (32%) | ||
LRR_4 | 126..166 | CDD:289563 | 16/72 (22%) | ||
LRR 4 | 127..150 | 10/46 (22%) | |||
leucine-rich repeat | 128..151 | CDD:275378 | 10/46 (22%) | ||
LRR 5 | 151..172 | 7/29 (24%) | |||
leucine-rich repeat | 152..165 | CDD:275378 | 5/21 (24%) | ||
leucine-rich repeat | 189..201 | CDD:275378 | 0/11 (0%) | ||
TPKR_C2 | 197..240 | CDD:301599 | 8/42 (19%) | ||
IG_like | 258..341 | CDD:214653 | 11/82 (13%) | ||
IGc2 | 264..328 | CDD:197706 | 8/63 (13%) | ||
fn3 | 366..438 | CDD:278470 | 2/14 (14%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 507..561 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |