DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lrit1b

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b / 553432 ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio


Alignment Length:360 Identity:81/360 - (22%)
Similarity:130/360 - (36%) Gaps:82/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SCPRNCLC----LED---FKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAV 149
            |||..|.|    |.|   .:.|.|.:..||.:|.:.|..|:.:.:....::.:....|..||...
Zfish    22 SCPAQCSCFYHKLSDGSKSRSVLCNDPDLTDIPDNFPLDASKLRIEKTSLSRISSAPFQQLSSLE 86

  Fly   150 EINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSF 214
            .:.::.|.:|||..|.|:|...|..||:..|.||....:.......|.||||.||.|        
Zfish    87 YLWISFNSLSSISPDTFRGLYALDELRMDGNVLTSFPWECLLDMPSLRLLDLHNNKI-------- 143

  Fly   215 LNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDF---KQQINTKAFSPLTKIIKLKLPE 276
                            :.:|.:....:..|..|.|:.|..   ..::....|||        .|.
Zfish   144 ----------------SSIPAEATLYIRNLTYLDLSSNSLTTVPPEVLMSWFSP--------KPP 184

  Fly   277 LEQQNIEEL-----------CSLLTSI-------DTISFLNYDISCYEFVLGTPFNGSLIYPTEP 323
            |:.:....:           |.|...:       .:::|::..:.|.|     |.:.|.:..::.
Zfish   185 LDAEGSRMILGLHDNPWQCDCRLFDLVQFQKFPSSSVAFIDTGLRCAE-----PESLSGVLFSDA 244

  Fly   324 PLKGITNPPIVASITSTAKPV----------TATPAPPRSANRNRGKMDNST---ELVKAGILSS 375
            .|:....|.:..::......:          ...|.|..|..|..||..|.|   |:.|.||:.|
Zfish   245 ELRRCQIPRVHTAVARVRSSIGNNVLLRCGTIGVPIPELSWARADGKPMNGTVQQEVSKEGIIWS 309

  Fly   376 ETSTSGVSVEPPAE---SQTNQVQISQEAINTLLI 407
            ..|...||.....:   ..||.|. |.:||.:|:|
Zfish   310 ILSVPAVSYRDSGKYVCKATNFVG-SADAIISLVI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 14/55 (25%)
leucine-rich repeat 128..147 CDD:275380 2/18 (11%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_RI <150..225 CDD:238064 21/74 (28%)
LRR_8 171..254 CDD:290566 19/82 (23%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 1/22 (5%)
leucine-rich repeat 244..268 CDD:275380 7/26 (27%)
lrit1bNP_001036218.1 LRR_RI <59..168 CDD:238064 30/132 (23%)
leucine-rich repeat 64..84 CDD:275380 2/19 (11%)
LRR_8 83..143 CDD:290566 21/59 (36%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
leucine-rich repeat 109..132 CDD:275380 6/22 (27%)
LRR_8 131..>176 CDD:290566 13/68 (19%)
LRR_4 131..172 CDD:289563 13/64 (20%)
leucine-rich repeat 133..156 CDD:275380 9/46 (20%)
leucine-rich repeat 157..175 CDD:275380 4/17 (24%)
leucine-rich repeat 185..203 CDD:275378 1/17 (6%)
LRRCT 199..243 CDD:214507 7/48 (15%)
I-set 252..343 CDD:254352 24/91 (26%)
IGc2 265..333 CDD:197706 18/67 (27%)
FN3 459..526 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.