DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Lrrc17

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001020326.1 Gene:Lrrc17 / 502715 RGDID:1560165 Length:446 Species:Rattus norvegicus


Alignment Length:149 Identity:41/149 - (27%)
Similarity:64/149 - (42%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ETAENRLMPQSSSTSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDM 120
            |..:.||.|....:......||..:.....|:|.            ..:.:.|....|..||.::
  Rat   219 EEEKERLDPIPQVSGVPAVIRPEADSTLCHNYVF------------PIQTLDCKRKELKKVPNNI 271

  Fly   121 PKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKI 185
            |.....:|||:|.|::|||::|.::....::||:.|.:..||...|.|...|:.|.|:||.|...
  Rat   272 PPNIVKLDLSYNKISQLRPKEFEDVHELKKLNLSSNGLEFIDPAAFLGLIHLEELDLSNNSLQSF 336

  Fly   186 DPDTFAAAKELTLLDLSNN 204
            |.........|.||.|.:|
  Rat   337 DYGVLEDLYFLKLLWLRDN 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 21/55 (38%)
leucine-rich repeat 128..147 CDD:275380 9/18 (50%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_RI <150..225 CDD:238064 19/55 (35%)
LRR_8 171..254 CDD:290566 12/34 (35%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 5/9 (56%)
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..268 CDD:275380
Lrrc17NP_001020326.1 leucine-rich repeat 68..86 CDD:275380
LRR_8 89..146 CDD:290566
leucine-rich repeat 89..111 CDD:275380
LRR_4 110..151 CDD:289563
leucine-rich repeat 112..135 CDD:275380
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..210 CDD:275380
TPKR_C2 168..>204 CDD:301599
leucine-rich repeat 211..274 CDD:275380 13/66 (20%)
LRR_8 273..333 CDD:290566 21/59 (36%)
LRR_4 273..314 CDD:289563 13/40 (33%)
leucine-rich repeat 275..298 CDD:275380 9/22 (41%)
LRR_4 299..337 CDD:289563 13/37 (35%)
leucine-rich repeat 299..322 CDD:275380 7/22 (32%)
leucine-rich repeat 323..346 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.