DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Tollo

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:311 Identity:72/311 - (23%)
Similarity:128/311 - (41%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLLIFLLSVSISH-TNAAPAGSEEANPLEDFNYGDDDYSETATG--EESPE-----TAENRLMP 64
            |||.:.::.:|.:. |:..|....|...|::....::..:..|.|  .|..|     .|.|.|..
  Fly   256 GLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNS 320

  Fly    65 QSSSTSTTTTFRPIF-------NIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVP----L 118
            |..:.:|....:.:.       .|.|...|:..|......|.|||        .::..:|    .
  Fly   321 QWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLED--------NYIDQLPGGIFA 377

  Fly   119 DMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLT 183
            |:.....:| ||.|.|:.:.......|...:.::|:.|.||.:|:.......:|:.|.|.:|:|.
  Fly   378 DLTNLHTLI-LSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQ 441

  Fly   184 KIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLR 248
            .: |:..|..:.|..||:..|.|:|..:.|......|........|.|.:....|..||.|::|.
  Fly   442 AV-PEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILN 505

  Fly   249 LNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELCSLLTSIDTISFLN 299
            |::|..|   :.:|.| |.:..:|:...|:...::.:..|.|.:..:.:||
  Fly   506 LSQNKLK---SIEAGS-LQRNSQLQAIRLDGNQLKSIAGLFTELPNLVWLN 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 15/55 (27%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 20/74 (27%)
LRR_8 171..254 CDD:290566 24/82 (29%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..268 CDD:275380 8/23 (35%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 6/24 (25%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 72/311 (23%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380 2/2 (100%)
leucine-rich repeat 260..283 CDD:275380 4/22 (18%)
LRR_RI 276..558 CDD:238064 66/291 (23%)
leucine-rich repeat 284..307 CDD:275380 4/22 (18%)
leucine-rich repeat 308..333 CDD:275380 5/24 (21%)
leucine-rich repeat 334..357 CDD:275380 4/22 (18%)
leucine-rich repeat 358..381 CDD:275380 6/30 (20%)
leucine-rich repeat 382..405 CDD:275380 6/23 (26%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 7/22 (32%)
leucine-rich repeat 453..500 CDD:275380 12/46 (26%)
leucine-rich repeat 501..521 CDD:275380 8/23 (35%)
leucine-rich repeat 525..547 CDD:275380 4/21 (19%)
leucine-rich repeat 548..573 CDD:275380 2/5 (40%)
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.