DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and CG7896

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:109/251 - (43%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VLEPSCPRNCLCLEDFKFVQCANAHLTHVP---LDMPKTAAIIDLSHNVIAELRPEDFANLSRAV 149
            ::|....:.|:.|::|...:.:   ||.||   |:.|.....:.|..|.|..|..:.| |..|.:
  Fly   174 LIEEGLLKGCMDLKEFYIDRNS---LTSVPTNSLNGPSALRHLSLRQNQIGSLLADSF-NAQRQL 234

  Fly   150 E-INLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQ----- 208
            | |:|.||:|.|||...|:|.::::.::||.||::.::.|.|...:.|..||||.|...|     
  Fly   235 EIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVA 299

  Fly   209 ----------RLDGSFLNQPDLVEFSCVNC---------SWTELPEQTFQNMSGLEVLRLNKNDF 254
                      .|..:.|.|.|......|..         :.|.:...||:.|..|:.|.|:.|..
  Fly   300 LAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSL 364

  Fly   255 KQQINTKAFSPL----TKIIK----LKLPELEQQNIEELCSLLTSIDTISFLNYDI 302
            : .|...|...|    |.|||    |.:|......:.:|.||....:.::.|:.:|
  Fly   365 R-TIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 21/56 (38%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 11/23 (48%)
LRR_RI <150..225 CDD:238064 28/90 (31%)
LRR_8 171..254 CDD:290566 26/106 (25%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 10/37 (27%)
leucine-rich repeat 220..243 CDD:275380 5/31 (16%)
leucine-rich repeat 244..268 CDD:275380 7/27 (26%)
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 46/167 (28%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566 12/48 (25%)
leucine-rich repeat 162..185 CDD:275380 2/10 (20%)
leucine-rich repeat 186..209 CDD:275380 8/25 (32%)
leucine-rich repeat 210..233 CDD:275380 6/23 (26%)
LRR_8 232..290 CDD:290566 23/57 (40%)
leucine-rich repeat 234..257 CDD:275380 11/22 (50%)
leucine-rich repeat 258..281 CDD:275380 6/22 (27%)
LRR_RI 273..535 CDD:238064 36/148 (24%)
LRR_8 281..338 CDD:290566 12/56 (21%)
leucine-rich repeat 282..329 CDD:275380 12/46 (26%)
LRR_8 328..388 CDD:290566 15/60 (25%)
leucine-rich repeat 330..353 CDD:275380 4/22 (18%)
leucine-rich repeat 354..377 CDD:275380 7/23 (30%)
leucine-rich repeat 378..401 CDD:275380 6/22 (27%)
leucine-rich repeat 402..425 CDD:275380 5/18 (28%)
leucine-rich repeat 428..451 CDD:275380
LRR_8 429..487 CDD:290566
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
LRR_8 498..558 CDD:290566
leucine-rich repeat 500..523 CDD:275380
LRR_RI 502..769 CDD:238064
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
LRR_8 572..630 CDD:290566
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
LRR_8 619..678 CDD:290566
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
LRR_8 666..726 CDD:290566
leucine-rich repeat 668..691 CDD:275380
leucine-rich repeat 692..715 CDD:275380
LRR_8 714..774 CDD:290566
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
LRR_RI <878..1070 CDD:238064
LRR_8 884..944 CDD:290566
LRR_4 884..925 CDD:289563
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.