DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and cDIP

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:475 Identity:92/475 - (19%)
Similarity:157/475 - (33%) Gaps:173/475 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EANPLED---FNYGDDDYSETATGEESPETAENRLMPQSSSTSTTTTFRPIFNIPRRSNHVLEPS 92
            |....||   :..||:::|.|...|....|                      |.|.|..:.||.|
  Fly    77 EVRIAEDGTTYEVGDEEHSRTLIFENCTFT----------------------NFPLRLFYTLEVS 119

  Fly    93 ------CPRNCLCLEDFK-------FVQCANAHLTHVPLDMPKTAA---IIDLSHNVIAELRPED 141
                  |....:..|:|.       .:..::.|:..:|....:.|.   .|.|:.|.:.:|:...
  Fly   120 ELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGA 184

  Fly   142 FANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTI 206
            |.||.:...::|..|.:.::..|||.|.:.|:.:.||.|:||.|:.|.||...:|..:.:.||.:
  Fly   185 FDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRL 249

  Fly   207 TQRLDGSF--------------LNQPDLV---------EFSCVNCS------------------- 229
            .:..:.:|              .|.|:||         ..:..|||                   
  Fly   250 REVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDNR 314

  Fly   230 ---------------------------------------------------W------------- 230
                                                               |             
  Fly   315 VRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNT 379

  Fly   231 --TELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELCSLLTSID 293
              .|||.:..|.|..|:.|.::.|:. .:|:..||..||::....:    ..|.....||...:|
  Fly   380 GQMELPLEALQGMQNLQKLDISGNNL-TEIDPSAFPTLTQLTHFYI----HGNNWNCFSLRNIMD 439

  Fly   294 TISFLN---YDISCY--EFVLGTPFNGSLIYPTEPPLKGI---TNPPIVASITSTAKPVTATPAP 350
            .:...|   |.:..|  :|. |..|:|.......|..:|:   ::..|.||:.|:  |:|::..|
  Fly   440 VLIRANGIAYTVDNYDPDFP-GEYFHGIACMYRLPEKEGVDSSSSSEISASVESS--PITSSSDP 501

  Fly   351 PRSANRNRGKMDNSTELVKA 370
                    .::|...:.:||
  Fly   502 --------SEVDKLRDELKA 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 17/55 (31%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 24/97 (25%)
LRR_8 171..254 CDD:290566 30/190 (16%)
leucine-rich repeat 172..195 CDD:275380 10/22 (45%)
leucine-rich repeat 196..219 CDD:275380 5/36 (14%)
leucine-rich repeat 220..243 CDD:275380 11/116 (9%)
leucine-rich repeat 244..268 CDD:275380 7/23 (30%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 4/23 (17%)
LRR_RI 143..407 CDD:238064 46/264 (17%)
leucine-rich repeat 143..166 CDD:275380 3/22 (14%)
LRR_8 166..225 CDD:290566 17/58 (29%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 6/22 (27%)
leucine-rich repeat 215..238 CDD:275380 10/22 (45%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 7/58 (12%)
LRR_8 304..357 CDD:290566 0/52 (0%)
leucine-rich repeat 326..347 CDD:275380 0/20 (0%)
leucine-rich repeat 348..394 CDD:275380 6/45 (13%)
LRR_8 369..428 CDD:290566 13/63 (21%)
LRR_4 393..433 CDD:289563 9/44 (20%)
leucine-rich repeat 395..418 CDD:275380 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.