DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and CG7800

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:354 Identity:79/354 - (22%)
Similarity:133/354 - (37%) Gaps:105/354 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIFLLSVSISHTNAAPAGSEEANPLEDFNYGDDDY------SETATGEESPETAE--------- 59
            |:|..|..|:|     ..|..:   |||  |.:|.|      |.|.:.:::.:..|         
  Fly     3 LIIIALLASVS-----ALGRPD---LED--YCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKK 57

  Fly    60 -NRLMPQ------SSSTSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLED--------FKFVQCA 109
             .:|||.      .:..|...|...:..:|..::..|...   |.|.|.|        .|.:...
  Fly    58 VLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRG---NLLGLHDEHFSKWPNMKILMLG 119

  Fly   110 NAHLTHVPLDMPKTAA---IIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSER 171
            ..::|.:..:..|..|   ::.|..|.|..|..:.|.||...:.::|:.|.|.::.:::|.|..:
  Fly   120 GNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPK 184

  Fly   172 LKRLRLANNRLTKIDPDTFAAAKELTLLDLSN----------NTITQRLDGSFLNQPDLVEFSCV 226
            |:.|.|..|.||.|.|.:..:...|.|||:||          ...|..||.|.:.:.|:      
  Fly   185 LEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDI------ 243

  Fly   227 NCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEEL---CSL 288
                          :..:..|:..||               .|.::|||  ::.::.||   .:|
  Fly   244 --------------LGSVHKLQARKN---------------HITEIKLP--DKSSVIELDLHSNL 277

  Fly   289 LTSIDTISFL-------NYDISCYEFVLG 310
            ||:.|....|       ..|:|  |.::|
  Fly   278 LTATDIPKLLTGMWRLQRLDLS--ENIIG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 16/55 (29%)
leucine-rich repeat 128..147 CDD:275380 7/18 (39%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 24/84 (29%)
LRR_8 171..254 CDD:290566 22/92 (24%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 10/32 (31%)
leucine-rich repeat 220..243 CDD:275380 0/22 (0%)
leucine-rich repeat 244..268 CDD:275380 3/23 (13%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/17 (18%)
leucine-rich repeat 65..85 CDD:275380 2/19 (11%)
LRR_8 87..147 CDD:290566 12/62 (19%)
leucine-rich repeat 89..112 CDD:275380 5/25 (20%)
leucine-rich repeat 113..136 CDD:275380 3/22 (14%)
LRR_RI <131..334 CDD:238064 51/213 (24%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
LRR_8 140..195 CDD:290566 16/54 (30%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..246 CDD:275380 11/56 (20%)
leucine-rich repeat 247..267 CDD:275380 7/36 (19%)
leucine-rich repeat 268..292 CDD:275380 7/23 (30%)
leucine-rich repeat 293..322 CDD:275380 4/14 (29%)
leucine-rich repeat 395..406 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.