DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and CG4950

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster


Alignment Length:366 Identity:81/366 - (22%)
Similarity:144/366 - (39%) Gaps:75/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDP 187
            |.:.|.|:.|::.||..:.|.:.....:::...||::||..:||:...|:|.:.|:||||..|.|
  Fly   167 TISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHP 231

  Fly   188 DTFAAAKELTLL-----DLSNNTITQR-------LDGSFLNQPDLVEFSCVNCSWTELPEQTFQN 240
            ||||.|..|..|     :|.|..:|::       ||.::|....:.....|..|..::.|.....
  Fly   232 DTFADAASLENLVLSYNELKNFQLTEKNIVHQLHLDNNYLTNLTINATRFVRASHNQISELFLHQ 296

  Fly   241 MSGLEVLRLNKNDFKQ---------------------QINTKAFSPLTKIIKLKL-----PEL-- 277
            ...:|.|.|:.|....                     .:|...||.|.::..|.|     .||  
  Fly   297 SLHIETLDLSANKLSSISNITNITHMLYLDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELKF 361

  Fly   278 ----EQQNIEEL---CSLLTSIDTISFLNYDISCYEFVLG----TPFNGSLIYPTE-PPLK--GI 328
                :|:.:|||   .:.||.::...|:.|..:..:|::.    |...|:..:... |.|:  |:
  Fly   362 GMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKKFLIDGNGLTELQGNRTFSEAFPQLQKLGV 426

  Fly   329 TN--------------PPIVASITSTAKPVTATPAPPRSANRNRGKMDNSTELVKAGILSSETST 379
            :.              |.:..|:....:|.|.....|..  |:...:..|.|:|.|...:.|:  
  Fly   427 SRNRFNCSYLHHLLIPPSLPESVVLNIEPDTNLDETPHI--RDVSCISQSQEVVNASFTAEES-- 487

  Fly   380 SGVSVEPPAESQTNQVQISQEAINTLLICIMVLAVIGIVIG 420
               .:|...:..:.|:.|.......|.:.:..:.:...|:|
  Fly   488 ---KLESQIQMLSKQLDIVGSHSKNLELHLAFMQIFAYVMG 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 17/55 (31%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 28/86 (33%)
LRR_8 171..254 CDD:290566 29/94 (31%)
leucine-rich repeat 172..195 CDD:275380 13/22 (59%)
leucine-rich repeat 196..219 CDD:275380 8/34 (24%)
leucine-rich repeat 220..243 CDD:275380 3/22 (14%)
leucine-rich repeat 244..268 CDD:275380 8/44 (18%)
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380
LRR_8 118..178 CDD:290566 4/10 (40%)
leucine-rich repeat 120..143 CDD:275380
leucine-rich repeat 144..167 CDD:275380 81/366 (22%)
leucine-rich repeat 168..191 CDD:275380 6/22 (27%)
LRR_8 192..250 CDD:290566 22/57 (39%)
leucine-rich repeat 192..215 CDD:275380 6/22 (27%)
LRR_RI <207..432 CDD:238064 53/224 (24%)
leucine-rich repeat 216..239 CDD:275380 13/22 (59%)
leucine-rich repeat 240..299 CDD:275380 11/58 (19%)
LRR_8 299..356 CDD:290566 10/56 (18%)
leucine-rich repeat 300..321 CDD:275380 4/20 (20%)
leucine-rich repeat 322..345 CDD:275380 4/22 (18%)
LRR_8 344..405 CDD:290566 13/60 (22%)
leucine-rich repeat 346..365 CDD:275380 4/18 (22%)
leucine-rich repeat 370..394 CDD:275380 7/23 (30%)
leucine-rich repeat 395..420 CDD:275380 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.