DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Toll-6

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:118/277 - (42%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPLEDFN---YGDDDYSETATGEESPETAENRLMPQSSSTSTTTTFRPI--------------FN 80
            |.|:|.|   :.|.....|....||..|.|:.....|||||.:.....:              |.
  Fly   234 NRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFG 298

  Fly    81 IPRR------SNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDM-PKTAAIID---LSHNVIA 135
            ..||      :|:.:.....:....|::.:.:..::..:..:|.:: .:.|.||.   |.:|.|:
  Fly   299 TLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSIS 363

  Fly   136 ELRPEDFANLSRAVEINLNHNLISS--IDKDVFQGSERLKRLRLANNRLTKIDP----------- 187
            .|.|:.|:||.:...::|:.|.|:|  |||:.|.|..||..|.|::|:|||::|           
  Fly   364 VLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQI 428

  Fly   188 -------------DTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVE-FSCVNCSWTELPEQTF 238
                         ||||....|..|.||:|.: :.||...||...::. .|..|.:...:....|
  Fly   429 LNLRHNQLENIAADTFAPMNNLHTLLLSHNKL-KYLDAYALNGLYVLSLLSLDNNALIGVHPDAF 492

  Fly   239 QNMSGLEVLRLNKNDFK 255
            :|.|.|:.|.||.|..|
  Fly   493 RNCSALQDLNLNGNQLK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 24/60 (40%)
leucine-rich repeat 128..147 CDD:275380 8/21 (38%)
leucine-rich repeat 148..171 CDD:275380 9/24 (38%)
LRR_RI <150..225 CDD:238064 31/101 (31%)
LRR_8 171..254 CDD:290566 32/107 (30%)
leucine-rich repeat 172..195 CDD:275380 12/46 (26%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
leucine-rich repeat 220..243 CDD:275380 4/23 (17%)
leucine-rich repeat 244..268 CDD:275380 6/12 (50%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566 1/1 (100%)
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 15/43 (35%)
leucine-rich repeat 229..249 CDD:275380 5/14 (36%)
LRR_RI 278..468 CDD:238064 46/190 (24%)
leucine-rich repeat 279..302 CDD:275380 1/22 (5%)
LRR_8 301..386 CDD:290566 18/84 (21%)
leucine-rich repeat 303..326 CDD:275380 2/22 (9%)
leucine-rich repeat 327..350 CDD:275380 1/22 (5%)
LRR 350..729 CDD:227223 52/161 (32%)
leucine-rich repeat 352..375 CDD:275380 9/22 (41%)
leucine-rich repeat 376..401 CDD:275380 9/24 (38%)
LRR_RI <401..626 CDD:238064 33/110 (30%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 426..449 CDD:275380 4/22 (18%)
leucine-rich repeat 450..473 CDD:275380 9/23 (39%)
leucine-rich repeat 474..497 CDD:275380 4/22 (18%)
leucine-rich repeat 498..518 CDD:275380 6/12 (50%)
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.