DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and trn

DIOPT Version :10

Sequence 1:NP_648600.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:87/246 - (35%) Gaps:76/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LEP-----SCPRNCLCLEDFKFVQCANAHLTHVPLDMP-------------KT----------AA 125
            :||     :||..|.|.::...|||....|..:|:.:.             ||          ..
  Fly    21 VEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPSIQRLVIKSNKIKTIDSSIQFYAELT 85

  Fly   126 IIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQG--------------SE------ 170
            .:|||.|.:..:....||...:..|::||||.|..|....|.|              ||      
  Fly    86 FLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTF 150

  Fly   171 ----RLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWT 231
                :::.|.|..||:..:||..|....:|.:|.|.:|.:|        ..||.|          
  Fly   151 TPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALT--------TVPDPV---------- 197

  Fly   232 ELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNI 282
                 .||.|..|..|.|..|.. |.|...||..|..:.:|:|.....:||
  Fly   198 -----IFQAMPSLAELFLGMNTL-QSIQADAFQDLKGLTRLELKGASLRNI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_648600.1 LRR <127..>300 CDD:443914 48/180 (27%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 11/46 (24%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 9/23 (39%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 2/17 (12%)
LRR 82..406 CDD:443914 48/185 (26%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 2/22 (9%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..204 CDD:275380 11/46 (24%)
leucine-rich repeat 205..228 CDD:275380 9/23 (39%)
leucine-rich repeat 229..252 CDD:275380 4/14 (29%)
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
leucine-rich repeat 301..322 CDD:275380
leucine-rich repeat 326..350 CDD:275380
leucine-rich repeat 351..373 CDD:275380
LRRCT 382..434 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.