DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and CG32055

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:311 Identity:70/311 - (22%)
Similarity:124/311 - (39%) Gaps:58/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLSVSISHTNAAPAGSEE-ANPLEDFNYGDDDYSETATGEESPETAENRLMPQSSSTSTTTTFRP 77
            |..::::|.......||: .||.|..|: |..|::..                :.:|...:.|..
  Fly   100 LQKLNLTHAQLDELKSEQFPNPSEMINF-DVSYNDIL----------------AITTKLMSGFGN 147

  Fly    78 IF--NIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPE 140
            :.  |.......|:||:..|:   :::.:|:.....:..::.|........:.:|:|.:.:.:..
  Fly   148 LVYANFSENLIAVIEPNAFRH---MKNLRFLDLTTNYQENITLGENANLRFLSISNNNLRDFQWC 209

  Fly   141 DFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKE---LTLLDLS 202
            ....|.:..|::|:.|.:..:|..:|.....|:.|.::||.|.:|....|.|..|   |.|||.|
  Fly   210 HLRVLPKLEELHLHSNWLEHLDMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYS 274

  Fly   203 NNTITQRLDGS-------------------------FLNQPDLVEFSCVNCSWTELPEQTFQNMS 242
            :| |.:.||.|                         ||....|..........:.||:..|.|::
  Fly   275 SN-IVKVLDDSVFCRLKKLRTLNLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLT 338

  Fly   243 GLEVLRLNKNDFKQQINTKAFSP--LTKIIKLKLPELEQQNIEELCSLLTS 291
            .||.|.|:||:. |::..:.|..  |.|:|.|   :|....|.:|..|..|
  Fly   339 ALEKLDLSKNNI-QKLGLRVFGERILRKLIYL---DLSNNYIADLHPLALS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 12/55 (22%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 27/102 (26%)
LRR_8 171..254 CDD:290566 32/110 (29%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 12/47 (26%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..268 CDD:275380 9/25 (36%)
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 128..180 CDD:290566 10/70 (14%)
leucine-rich repeat 128..147 CDD:275380 4/34 (12%)
leucine-rich repeat 148..171 CDD:275380 5/25 (20%)
leucine-rich repeat 172..192 CDD:275380 2/19 (11%)
LRR_RI <187..400 CDD:238064 52/204 (25%)
LRR_8 192..251 CDD:290566 12/58 (21%)
leucine-rich repeat 193..216 CDD:275380 3/22 (14%)
leucine-rich repeat 217..240 CDD:275380 5/22 (23%)
leucine-rich repeat 241..267 CDD:275380 9/25 (36%)
leucine-rich repeat 268..291 CDD:275380 10/23 (43%)
LRR_8 290..350 CDD:290566 13/59 (22%)
leucine-rich repeat 292..315 CDD:275380 2/22 (9%)
leucine-rich repeat 316..339 CDD:275380 5/22 (23%)
LRR_8 340..400 CDD:290566 17/50 (34%)
leucine-rich repeat 340..365 CDD:275380 9/25 (36%)
leucine-rich repeat 366..389 CDD:275380 7/23 (30%)
leucine-rich repeat 390..413 CDD:275380
LRR_8 391..448 CDD:290566
leucine-rich repeat 414..437 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.