| Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648354.1 | Gene: | CG6749 / 39144 | FlyBaseID: | FBgn0036040 | Length: | 552 | Species: | Drosophila melanogaster |
| Alignment Length: | 256 | Identity: | 71/256 - (27%) |
|---|---|---|---|
| Similarity: | 111/256 - (43%) | Gaps: | 45/256 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 NRLMPQSSSTSTTTTFRPI-----FNIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLD 119
Fly 120 MPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTK 184
Fly 185 IDPDTFAAAKELTLLDLSNNTI----TQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLE 245
Fly 246 VLRLNKNDFKQQINTKAFSPLTKIIKLKLPE--LEQQNIEELCSL------LTSIDTISFL 298 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 18/55 (33%) |
| leucine-rich repeat | 128..147 | CDD:275380 | 8/18 (44%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | <150..225 | CDD:238064 | 25/78 (32%) | ||
| LRR_8 | 171..254 | CDD:290566 | 27/86 (31%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 9/26 (35%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 244..268 | CDD:275380 | 8/23 (35%) | ||
| CG6749 | NP_648354.1 | LRR_RI | 103..>256 | CDD:238064 | 8/32 (25%) |
| LRR_8 | 104..164 | CDD:290566 | |||
| leucine-rich repeat | 106..129 | CDD:275380 | |||
| leucine-rich repeat | 130..153 | CDD:275380 | |||
| leucine-rich repeat | 154..195 | CDD:275380 | |||
| LRR_RI | 194..455 | CDD:238064 | 69/254 (27%) | ||
| LRR_8 | 194..254 | CDD:290566 | 8/30 (27%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| leucine-rich repeat | 220..243 | CDD:275380 | 7/19 (37%) | ||
| leucine-rich repeat | 244..267 | CDD:275380 | 5/31 (16%) | ||
| LRR_8 | 271..330 | CDD:290566 | 20/69 (29%) | ||
| leucine-rich repeat | 272..295 | CDD:275380 | 9/33 (27%) | ||
| leucine-rich repeat | 296..319 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 319..380 | CDD:290566 | 20/62 (32%) | ||
| leucine-rich repeat | 320..343 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 344..369 | CDD:275380 | 9/26 (35%) | ||
| LRR_8 | 368..428 | CDD:290566 | 14/60 (23%) | ||
| leucine-rich repeat | 370..393 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 394..417 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 418..441 | CDD:275380 | 9/22 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45453544 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||