DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Toll-7

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:199 Identity:50/199 - (25%)
Similarity:94/199 - (47%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFA 191
            ::|::|.::||..|..|.|:....:||::|.:.::.:.:|.||:.|:.:.|..|.|.::....|.
  Fly   277 LNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFH 341

  Fly   192 AAKELTLLDLSNNTIT-QRLDG-SFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDF 254
            ..::|.::|||.|.:| ..:|. :|.....|:..:..:.:.|.:..:||:.:..|::|.|..|..
  Fly   342 RLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSI 406

  Fly   255 KQQINTKAFSPLTKIIKLKLPELEQQNIEELCSLLTSIDTISFLNYDISCYEFVLGTPFNGSLIY 319
             ..|...||.||..:..|.|.|.....:::  .|...:..:|.|.             .|.:||.
  Fly   407 -GHIEDNAFLPLYNLHTLNLAENRLHTLDD--KLFNGLYVLSKLT-------------LNNNLIS 455

  Fly   320 PTEP 323
            ..||
  Fly   456 VVEP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 16/54 (30%)
leucine-rich repeat 128..147 CDD:275380 7/18 (39%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 20/76 (26%)
LRR_8 171..254 CDD:290566 21/84 (25%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 8/24 (33%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 9/23 (39%)
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 50/199 (25%)
LRR_8 247..308 CDD:290566 10/30 (33%)
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380 7/19 (37%)
LRR_8 297..356 CDD:290566 16/58 (28%)
leucine-rich repeat 298..321 CDD:275380 6/22 (27%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 16/60 (27%)
leucine-rich repeat 346..371 CDD:275380 8/24 (33%)
leucine-rich repeat 372..395 CDD:275380 4/22 (18%)
leucine-rich repeat 396..419 CDD:275380 9/23 (39%)
LRR_8 419..478 CDD:290566 11/56 (20%)
leucine-rich repeat 420..443 CDD:275380 4/24 (17%)
leucine-rich repeat 444..467 CDD:275380 7/29 (24%)
LRR_RI 466..622 CDD:238064
leucine-rich repeat 468..488 CDD:275380
LRR_8 491..549 CDD:290566
leucine-rich repeat 491..514 CDD:275380
leucine-rich repeat 515..536 CDD:275380
leucine-rich repeat 539..562 CDD:275380
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.