DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and CG18480

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:422 Identity:88/422 - (20%)
Similarity:151/422 - (35%) Gaps:87/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RSNHVLEPSCPRNCLCLEDFKFVQ----CANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFAN 144
            ||....:..||..|.|  |....:    |:...|....:::|.|..::|||:|.|..:..:.|..
  Fly    34 RSKTQSQMFCPTVCHC--DLHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKT 96

  Fly   145 LSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQR 209
            ....:.:.|.||.|.::..|.|....||:.|.|:.|||.:||.....:..:|..|:|..|.::..
  Fly    97 TIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTL 161

  Fly   210 LDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKN--------DFKQQINTKAFS-- 264
            ..|..|..|.|...:..|....:|..|....:..|..|.|.:|        ||....|..:.:  
  Fly   162 GKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVE 226

  Fly   265 --------PLTKIIKLKLPELEQQNI---------EELCSLLTSIDTISFLNYD--ISCYEFVLG 310
                    .|.|:    ...|.|:.:         ||:.......:.::|.|.:  ....|::  
  Fly   227 ENPFNCDRALAKV----ATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESMEYL-- 285

  Fly   311 TPFNGSLIYPTEPPLKGITNPPIVASITSTAKPVTATPAPPRSANRNRGKMDNSTELVKAG---- 371
                       ||..:|   |..|.|:..     ....:..::::::..:|.:.:::.:..    
  Fly   286 -----------EPSTRG---PQSVLSVWR-----DLDSSEEQNSSQDDEQMSSLSDVCEGSREKL 331

  Fly   372 ILSSETSTSGVSVEPPAESQTNQVQISQEAINT-------LLICIM------VLAVIGIVIGLIC 423
            .|........||.|..|...:   |:..|.|.|       |.:..:      |..||.|:...:|
  Fly   332 CLRYRICLERVSHELLAGGNS---QLEDEIIRTHTYDEDDLKLAFVVGGATGVCMVIFIITFALC 393

  Fly   424 RQDIGGIKTKCCRTSKPEPKDQVHPTEEIPLN 455
            .:       .||...|.:...:|......|||
  Fly   394 LK-------SCCEMRKKKSNPEVATGVSAPLN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 17/55 (31%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_RI <150..225 CDD:238064 23/74 (31%)
LRR_8 171..254 CDD:290566 24/90 (27%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 8/41 (20%)
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 18/59 (31%)
LRR_RI <76..230 CDD:238064 39/153 (25%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 122..182 CDD:290566 18/59 (31%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_8 170..230 CDD:290566 12/59 (20%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.