| Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014075.1 | Gene: | Lrrc26 / 311803 | RGDID: | 1308398 | Length: | 334 | Species: | Rattus norvegicus |
| Alignment Length: | 257 | Identity: | 71/257 - (27%) |
|---|---|---|---|
| Similarity: | 106/257 - (41%) | Gaps: | 28/257 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 60 NRLMPQSS---------STSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTH 115
Fly 116 VPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANN 180
Fly 181 RLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQ-PDLVEFSCVNCSWTELPEQTFQNMSGL 244
Fly 245 EVLRLNKNDFKQQINTKAFSPL-TKIIKLKLPELEQQNIEELC--------SLLTSIDTISF 297 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 16/55 (29%) |
| leucine-rich repeat | 128..147 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | <150..225 | CDD:238064 | 23/75 (31%) | ||
| LRR_8 | 171..254 | CDD:290566 | 27/83 (33%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 244..268 | CDD:275380 | 9/24 (38%) | ||
| Lrrc26 | NP_001014075.1 | LRR_8 | 76..135 | CDD:290566 | 16/58 (28%) |
| LRR 1 | 76..97 | 5/20 (25%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 6/22 (27%) | ||
| LRR 2 | 100..121 | 4/20 (20%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 124..145 | 9/20 (45%) | |||
| LRR_8 | 125..183 | CDD:290566 | 19/58 (33%) | ||
| LRR_4 | 125..164 | CDD:289563 | 14/39 (36%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 9/22 (41%) | ||
| LRR 4 | 148..169 | 7/21 (33%) | |||
| leucine-rich repeat | 149..172 | CDD:275380 | 7/23 (30%) | ||
| LRR 5 | 172..194 | 4/21 (19%) | |||
| leucine-rich repeat | 173..196 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 197..239 | CDD:275380 | 15/46 (33%) | ||
| TPKR_C2 | 205..258 | CDD:301599 | 14/55 (25%) | ||
| leucine-rich repeat | 240..259 | CDD:275380 | 4/15 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 312..334 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||