DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and Lrrc3c

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_038943323.1 Gene:Lrrc3c / 287668 RGDID:1563281 Length:255 Species:Rattus norvegicus


Alignment Length:132 Identity:34/132 - (25%)
Similarity:61/132 - (46%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PIFNIPRRSNHVLEP-SCPRNCLCLEDF--KFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELR 138
            |:..:......|..| :.|:.|...|:.  :..:|:.|.|:.||..:|.....:.|..|.:|.:.
  Rat    10 PLLLVIGTGRSVSSPQTLPQGCYIAEEAGEQTFRCSRAGLSAVPSGIPNDTRKLYLDANQLASVP 74

  Fly   139 PEDFANLSRAVEINLNHNLISSIDKDVFQGSE-RLKRLRLANNRLTKIDPDTFAAAKELTLLDLS 202
            ...|.:|....|::|:||::..:....|||.| .|:.|.|:.|:|..:....|...:  ..::||
  Rat    75 AGAFQHLPALEELDLSHNVLVHLSGAAFQGLEATLRHLDLSANQLASVPVAAFVGLQ--IQVNLS 137

  Fly   203 NN 204
            .|
  Rat   138 AN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 17/56 (30%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 8/23 (35%)
LRR_RI <150..225 CDD:238064 17/56 (30%)
LRR_8 171..254 CDD:290566 9/34 (26%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 3/9 (33%)
leucine-rich repeat 220..243 CDD:275380
leucine-rich repeat 244..268 CDD:275380
Lrrc3cXP_038943323.1 leucine-rich repeat 40..59 CDD:275378 6/18 (33%)
leucine-rich repeat 60..83 CDD:275378 5/22 (23%)
LRR_8 61..119 CDD:404697 17/57 (30%)
leucine-rich repeat 84..107 CDD:275378 7/22 (32%)
leucine-rich repeat 109..131 CDD:275378 6/21 (29%)
leucine-rich repeat 132..143 CDD:275378 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.