Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128215.1 | Gene: | Lrrtm4 / 243499 | MGIID: | 2389180 | Length: | 591 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 68/240 - (28%) |
---|---|---|---|
Similarity: | 107/240 - (44%) | Gaps: | 28/240 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 SCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHN 156
Fly 157 LISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLV 221
Fly 222 EFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPE---------- 276
Fly 277 -----------LEQQNIEELCSLLT----SIDTISFLNYDISCYE 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 24/55 (44%) |
leucine-rich repeat | 128..147 | CDD:275380 | 7/18 (39%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 11/22 (50%) | ||
LRR_RI | <150..225 | CDD:238064 | 28/74 (38%) | ||
LRR_8 | 171..254 | CDD:290566 | 25/82 (30%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 244..268 | CDD:275380 | 7/23 (30%) | ||
Lrrtm4 | NP_001128215.1 | leucine-rich repeat | 44..62 | CDD:275380 | 4/17 (24%) |
leucine-rich repeat | 65..87 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 87..146 | CDD:316378 | 26/58 (45%) | ||
leucine-rich repeat | 88..111 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 112..135 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 134..194 | CDD:316378 | 16/59 (27%) | ||
leucine-rich repeat | 136..159 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 160..183 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 184..207 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 208..231 | CDD:275380 | 2/22 (9%) | ||
LRR_8 | 231..290 | CDD:316378 | 9/40 (23%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 256..279 | CDD:275380 | 4/15 (27%) | ||
leucine-rich repeat | 304..316 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |