| Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666164.1 | Gene: | Lrrc3b / 218763 | MGIID: | 2384996 | Length: | 259 | Species: | Mus musculus |
| Alignment Length: | 215 | Identity: | 56/215 - (26%) |
|---|---|---|---|
| Similarity: | 92/215 - (42%) | Gaps: | 25/215 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 CPRNCLCLEDFKF-VQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHN 156
Fly 157 LISSIDKDVFQG-SERLKRLRLANNRLTKIDPDTF----AAAKELTLLDLSNN------TITQRL 210
Fly 211 DGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSG-LEVLRLNKNDFKQQINTKAFSPLTKIIKLKL 274
Fly 275 PELEQ------QNIEELCSL 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 19/56 (34%) |
| leucine-rich repeat | 128..147 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 8/23 (35%) | ||
| LRR_RI | <150..225 | CDD:238064 | 23/85 (27%) | ||
| LRR_8 | 171..254 | CDD:290566 | 20/93 (22%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 6/28 (21%) | ||
| leucine-rich repeat | 220..243 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 244..268 | CDD:275380 | 3/23 (13%) | ||
| Lrrc3b | NP_666164.1 | LRRNT | 33..68 | CDD:214470 | 13/33 (39%) |
| LRR 1 | 65..86 | 5/20 (25%) | |||
| leucine-rich repeat | 66..89 | CDD:275378 | 6/22 (27%) | ||
| LRR_8 | 69..125 | CDD:404697 | 19/55 (35%) | ||
| LRR 2 | 89..110 | 7/20 (35%) | |||
| leucine-rich repeat | 90..113 | CDD:275378 | 8/22 (36%) | ||
| LRR 3 | 114..135 | 6/20 (30%) | |||
| leucine-rich repeat | 115..138 | CDD:275378 | 6/22 (27%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 2 | 1.870 | |||||