Sequence 1: | NP_001163434.1 | Gene: | CG42709 / 39453 | FlyBaseID: | FBgn0261674 | Length: | 458 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073982.3 | Gene: | CPN2 / 1370 | HGNCID: | 2313 | Length: | 545 | Species: | Homo sapiens |
Alignment Length: | 216 | Identity: | 60/216 - (27%) |
---|---|---|---|
Similarity: | 93/216 - (43%) | Gaps: | 36/216 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 CPRNCLCLEDFKFVQ---CANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLN 154
Fly 155 HNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPD 219
Fly 220 LVEFSCVNCSWTE-LPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPE-LEQQNI 282
Fly 283 EELCSLLTSIDTISFLNYDIS 303 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42709 | NP_001163434.1 | LRR_8 | 126..182 | CDD:290566 | 7/55 (13%) |
leucine-rich repeat | 128..147 | CDD:275380 | 3/18 (17%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 1/22 (5%) | ||
LRR_RI | <150..225 | CDD:238064 | 12/74 (16%) | ||
LRR_8 | 171..254 | CDD:290566 | 23/83 (28%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 220..243 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 244..268 | CDD:275380 | 9/23 (39%) | ||
CPN2 | NP_001073982.3 | LRRNT | 21..53 | CDD:214470 | 14/41 (34%) |
leucine-rich repeat | 30..53 | CDD:275380 | 9/28 (32%) | ||
leucine-rich repeat | 75..98 | CDD:275380 | 6/22 (27%) | ||
LRR 1 | 98..119 | 3/20 (15%) | |||
leucine-rich repeat | 99..122 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 121..181 | CDD:290566 | 20/61 (33%) | ||
LRR 2 | 122..143 | 7/21 (33%) | |||
leucine-rich repeat | 123..146 | CDD:275380 | 8/23 (35%) | ||
LRR 3 | 146..167 | 7/21 (33%) | |||
leucine-rich repeat | 147..170 | CDD:275380 | 9/23 (39%) | ||
LRR_RI | 149..>356 | CDD:238064 | 21/59 (36%) | ||
LRR_8 | 169..229 | CDD:290566 | 14/38 (37%) | ||
LRR 4 | 170..191 | 7/20 (35%) | |||
leucine-rich repeat | 171..194 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 194..215 | 4/13 (31%) | |||
leucine-rich repeat | 195..218 | CDD:275380 | 3/12 (25%) | ||
LRR_8 | 218..277 | CDD:290566 | |||
LRR 6 | 218..239 | ||||
leucine-rich repeat | 219..242 | CDD:275380 | |||
LRR 7 | 242..263 | ||||
leucine-rich repeat | 243..266 | CDD:275380 | |||
LRR 8 | 266..287 | ||||
leucine-rich repeat | 267..290 | CDD:275380 | |||
LRR 9 | 290..311 | ||||
leucine-rich repeat | 291..314 | CDD:275380 | |||
LRR_8 | 294..349 | CDD:290566 | |||
LRR 10 | 314..335 | ||||
leucine-rich repeat | 315..338 | CDD:275380 | |||
LRR 11 | 338..359 | ||||
leucine-rich repeat | 339..359 | CDD:275380 | |||
LRR 12 | 362..383 | ||||
leucine-rich repeat | 363..382 | CDD:275380 | |||
leucine-rich repeat | 387..399 | CDD:275378 | |||
LRRCT | 395..446 | CDD:214507 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |