DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and LRRC38

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001010847.1 Gene:LRRC38 / 126755 HGNCID:27005 Length:294 Species:Homo sapiens


Alignment Length:189 Identity:54/189 - (28%)
Similarity:83/189 - (43%) Gaps:28/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VLEP--SCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVE 150
            :|.|  :||..|.| .|...|.|.:..|..||...|.....:.::.|.|..: ||||.       
Human    21 LLAPGHACPAGCAC-TDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQRI-PEDFF------- 76

  Fly   151 INLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFL 215
                          :|.|.  |..|...||.|..::..||:.:.:|..||||.|.:||...|:|.
Human    77 --------------IFYGD--LVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFR 125

  Fly   216 NQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKL 274
            :...||:.|..|.:...:.|..|:.:..|:||.||.|:.: .::..|.:.|..:..|:|
Human   126 SAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLR-SLSVAALAALPALRSLRL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 12/55 (22%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 2/22 (9%)
LRR_RI <150..225 CDD:238064 21/74 (28%)
LRR_8 171..254 CDD:290566 29/82 (35%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 10/22 (45%)
leucine-rich repeat 220..243 CDD:275380 6/22 (27%)
leucine-rich repeat 244..268 CDD:275380 8/23 (35%)
LRRC38NP_001010847.1 LRRNT 27..58 CDD:214470 11/31 (35%)
leucine-rich repeat 38..56 CDD:275380 5/17 (29%)
LRR_RI <45..>165 CDD:238064 41/143 (29%)
LRR 1 57..78 6/42 (14%)
LRR_8 58..116 CDD:290566 21/81 (26%)
leucine-rich repeat 58..81 CDD:275378 7/44 (16%)
LRR 2 81..102 7/22 (32%)
leucine-rich repeat 82..105 CDD:275378 7/22 (32%)
LRR 3 105..126 10/20 (50%)
leucine-rich repeat 106..129 CDD:275378 10/22 (45%)
LRR_8 109..164 CDD:290566 21/54 (39%)
LRR 4 129..150 6/20 (30%)
leucine-rich repeat 130..153 CDD:275378 6/22 (27%)
LRR 5 153..174 7/21 (33%)
leucine-rich repeat 154..165 CDD:275378 6/10 (60%)
leucine-rich repeat 178..197 CDD:275380 2/6 (33%)
TPKR_C2 186..237 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.