DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42709 and LRRC3C

DIOPT Version :9

Sequence 1:	NP_001163434.1	Gene:	CG42709 / 39453	FlyBaseID:	FBgn0261674	Length:	458	Species:	Drosophila melanogaster
Sequence 2:	NP_001182474.1	Gene:	LRRC3C / 100505591	HGNCID:	40034	Length:	275	Species:	Homo sapiens

Alignment Length:	114	Identity:	31/114 - (27%)
Similarity:	56/114 - (49%)	Gaps:	5/114 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 PRNCLCLEDF--KFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHN 156
            ||.|...::.  :..:|:.|.|:.||..:|.....:.|..|.:|.:....|.:|....|::|:||
Human    49 PRGCYVAKEAGERTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHN 113

  Fly   157 LISSIDKDVFQGSE-RLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNN 204
            .::.:....|||.| .|:.|.|:.|:|..:..:.|...:  ..::||.|
Human   114 ALAHLSGAAFQGLEGTLRHLDLSANQLASVPVEAFVGLQ--IQVNLSAN 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42709	NP_001163434.1	LRR_8	126..182	CDD:290566	17/56 (30%)
		leucine-rich repeat	128..147	CDD:275380	5/18 (28%)
		leucine-rich repeat	148..171	CDD:275380	8/23 (35%)
		LRR_RI	<150..225	CDD:238064	17/56 (30%)
		LRR_8	171..254	CDD:290566	9/34 (26%)
		leucine-rich repeat	172..195	CDD:275380	6/22 (27%)
		leucine-rich repeat	196..219	CDD:275380	3/9 (33%)
		leucine-rich repeat	220..243	CDD:275380
		leucine-rich repeat	244..268	CDD:275380
LRRC3C	NP_001182474.1	leucine-rich repeat	61..80	CDD:275378	6/18 (33%)
		LRR 1	80..101		4/20 (20%)
		leucine-rich repeat	81..104	CDD:275378	5/22 (23%)
		LRR_8	82..140	CDD:290566	17/57 (30%)
		LRR_4	82..120	CDD:289563	9/37 (24%)
		LRR 2	104..125		5/20 (25%)
		LRR_4	105..144	CDD:289563	13/38 (34%)
		leucine-rich repeat	105..129	CDD:275378	8/23 (35%)
		LRR 3	129..150		6/20 (30%)
		leucine-rich repeat	130..152	CDD:275378	6/21 (29%)
		leucine-rich repeat	153..164	CDD:275378	3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910