DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lrrtm1

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002935525.1 Gene:lrrtm1 / 100493874 XenbaseID:XB-GENE-966481 Length:521 Species:Xenopus tropicalis


Alignment Length:422 Identity:86/422 - (20%)
Similarity:166/422 - (39%) Gaps:103/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEIN 152
            ::...|||.|.|  :.:|:.|.:.::|.:|.::..... :.|.:|.::||:...|..|.:...:.
 Frog    34 LVNSGCPRLCRC--EGRFLYCESQNVTEIPHNLSGVMG-LSLRYNSLSELQDGQFTGLIQLTWLY 95

  Fly   153 LNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQ 217
            |:||.|.:::.:.|....|:|.|.|::|::|.:...||.....|..:|||||.: |.|:....: 
 Frog    96 LDHNHIHTVEGNAFHKLRRVKELTLSSNKITHLANTTFRPMPNLRSVDLSNNNL-QSLEADLFH- 158

  Fly   218 PDLVEFSCVNCSWTEL---PEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLP--EL 277
             .|.:.:.::..:..:   |.:.||:...|:.|.|..|..| .:...:|:.|.|:.:|.|.  :|
 Frog   159 -GLRKLTTLHMRYNAIKFVPVRIFQDCRSLKFLDLGYNQLK-SLARNSFAGLFKLTELHLEHNDL 221

  Fly   278 EQQNIEELCSLLT-------------SIDTISFL----NYDISCYEFVLGTPFNGSLIYPTEPPL 325
            .:.|:.....||:             .::::.|:    ..|:|..|.....|.    ::.:.|.|
 Frog   222 VKVNLAHFPRLLSLHSLFMRRNKVTIVVNSLDFVWKLEKMDLSGNEIEYIEPH----VFESLPHL 282

  Fly   326 KGI---------TNPPIVASITSTAKPVTA----------------------------------- 346
            :.:         .:|.|:.|..|.:....|                                   
 Frog   283 ESLQLDSNRLTYVDPRILNSWKSLSSITLAGNNWDCGRNVCALASWLSAFKGRCDGNMLCTTPEY 347

  Fly   347 -----------------TPAPPRSANRNRGKMDNSTELVKAGILSSETSTSGVSVEPPAESQTNQ 394
                             .|..|.|||.....::||..:.    :.|.|:|| .:|:.....:|..
 Frog   348 AQGEDVLDAVYFFRLCDDPVDPTSANAISTALNNSDRIA----IDSPTATS-YNVQDTEGERTTN 407

  Fly   395 VQISQEA----INTLLICIMVLAVIGIVIGLI 422
            ||.:..|    .||:.|..:|...:.::...:
 Frog   408 VQTATVANEHHENTVQIHKVVTGTMALIFSFL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 16/55 (29%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 22/74 (30%)
LRR_8 171..254 CDD:290566 24/85 (28%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 4/25 (16%)
leucine-rich repeat 244..268 CDD:275380 7/23 (30%)
lrrtm1XP_002935525.1 LRRNT 38..>61 CDD:214470 8/24 (33%)
LRR 53..>316 CDD:227223 59/271 (22%)
leucine-rich repeat 70..90 CDD:275380 6/19 (32%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
LRR_8 114..173 CDD:338972 17/61 (28%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
leucine-rich repeat 139..162 CDD:275380 9/25 (36%)
leucine-rich repeat 163..186 CDD:275380 3/22 (14%)
leucine-rich repeat 187..210 CDD:275380 7/23 (30%)
leucine-rich repeat 211..234 CDD:275380 5/22 (23%)
leucine-rich repeat 235..257 CDD:275380 1/21 (5%)
leucine-rich repeat 258..281 CDD:275380 4/26 (15%)
leucine-rich repeat 282..300 CDD:275380 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.