DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42709 and lrrc3

DIOPT Version :9

Sequence 1:	NP_001163434.1	Gene:	CG42709 / 39453	FlyBaseID:	FBgn0261674	Length:	458	Species:	Drosophila melanogaster
Sequence 2:	XP_004917845.1	Gene:	lrrc3 / 100492333	XenbaseID:	XB-GENE-954052	Length:	258	Species:	Xenopus tropicalis

Alignment Length:	143	Identity:	45/143 - (31%)
Similarity:	71/143 - (49%)	Gaps:	11/143 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    92 SCPRNCLC--LEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLN 154
            :||::|.|  ::....|.|::..|..:|:|:|.....:.|..|.|.::....|.:|:...|::|:
Frog    31 TCPKSCQCSDIDGATVVHCSSRDLEEIPIDLPMDTVSLKLDANKIHQVPNNAFKDLNYLQELDLS 95

  Fly   155 HNLISSIDKDVFQG-SERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNN-----TITQRLDGS 213
            .|.|..||...|:| ||.||.|.|:.|::..|..:  |.||....:.||||     ...|.:...
Frog    96 RNSIEKIDLAAFKGVSEGLKLLDLSGNQIHSIPKE--ALAKLRAKIRLSNNPWHCDCSLQEMLRE 158

  Fly   214 FLNQPDLV-EFSC 225
            .:..||.| |.||
Frog   159 LILDPDTVNEISC 171

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42709	NP_001163434.1	LRR_8	126..182	CDD:290566	20/56 (36%)
		leucine-rich repeat	128..147	CDD:275380	5/18 (28%)
		leucine-rich repeat	148..171	CDD:275380	9/23 (39%)
		LRR_RI	<150..225	CDD:238064	28/81 (35%)
		LRR_8	171..254	CDD:290566	20/61 (33%)
		leucine-rich repeat	172..195	CDD:275380	8/22 (36%)
		leucine-rich repeat	196..219	CDD:275380	5/27 (19%)
		leucine-rich repeat	220..243	CDD:275380	4/7 (57%)
		leucine-rich repeat	244..268	CDD:275380
lrrc3	XP_004917845.1	LRRNT	32..65	CDD:214470	10/32 (31%)
		leucine-rich repeat	45..67	CDD:275378	6/21 (29%)
		LRR_8	67..124	CDD:338972	20/56 (36%)
		leucine-rich repeat	68..88	CDD:275378	5/19 (26%)
		leucine-rich repeat	89..112	CDD:275378	8/22 (36%)
		leucine-rich repeat	114..137	CDD:275378	9/24 (38%)
		TPKR_C2	144..>159	CDD:387596	2/14 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000