DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lrit3b

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:430 Identity:95/430 - (22%)
Similarity:149/430 - (34%) Gaps:144/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IFNIPRRSNHVL----------------EPSCPRNCLCL-------EDFKFVQCANAHLTHVPLD 119
            |.::|||:...|                .|:||..|.|:       :..:.|.|.|..||.:|:|
Zfish    21 ILHVPRRTMRPLLYADLSLCLALVVCAQSPACPSLCTCVLQGRSDTKGLRTVLCKNPALTAIPID 85

  Fly   120 MPKTAA------------------------IIDLSHNVIAELRPEDFANLSRAVEINLNHNLISS 160
            :|....                        .:.|::|.|:.|.|..|.|||...|:.|:.||:|:
Zfish    86 LPNDTVKFRLERTSVSRIFRGAFSAMPELLYLWLTYNSISVLHPRSFTNLSSLHELRLDGNLLST 150

  Fly   161 IDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNN---TITQRLDGSFLNQPDLVE 222
            ...:..:...||:.|.|.||||.:|........:.:|.||||:|   |:...|...:|       
Zfish   151 FPWEGLRDMPRLRTLGLHNNRLARIPLLAVRYLRNVTYLDLSSNRLSTLANDLTALWL------- 208

  Fly   223 FSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELCS 287
            ||..|        ||.::.    ||.|..|.:...                            |.
Zfish   209 FSDSN--------QTQRSF----VLGLQDNPWVCD----------------------------CR 233

  Fly   288 LLTSID-------TISFLNYDISCYE--FVLGTPFNGSLIYPTEPPLKGITNPPIVASITSTAK- 342
            |.|.:|       ::..|:..::|.|  .:.|.||....:.....|....:...|.|.:.||.. 
Zfish   234 LSTLLDISRGPESSLVLLDRFLTCSEPLDLAGVPFQSVELSRCRRPYVVTSATKITALLGSTVLL 298

  Fly   343 --PVTATPAPP----RSANRN----------RGKMDNS----------TELVKAGILSSETSTSG 381
              ..|..|.|.    :||.||          :..:|..          .|..:.|:..|..|.:|
Zfish   299 RCEATGHPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKLFGYVQESPRVGVRWSVVSLNG 363

  Fly   382 VSVEPPAESQ---TNQVQISQEAINTLLICIMVLAVIGIV 418
            :|.....|.:   .|...||:..::        |.|:|::
Zfish   364 ISYSDAGEYRCRAQNMAGISEAVVS--------LNVVGVM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 20/55 (36%)
leucine-rich repeat 128..147 CDD:275380 8/18 (44%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 24/77 (31%)
LRR_8 171..254 CDD:290566 27/85 (32%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 9/25 (36%)
leucine-rich repeat 220..243 CDD:275380 5/22 (23%)
leucine-rich repeat 244..268 CDD:275380 4/23 (17%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470 12/40 (30%)
leucine-rich repeat 69..89 CDD:275380 8/19 (42%)
LRR_8 112..172 CDD:290566 20/59 (34%)
leucine-rich repeat 114..137 CDD:275378 8/22 (36%)
leucine-rich repeat 138..161 CDD:275378 5/22 (23%)
LRR_8 160..214 CDD:290566 21/68 (31%)
LRR_4 160..201 CDD:289563 16/40 (40%)
leucine-rich repeat 162..185 CDD:275378 8/22 (36%)
leucine-rich repeat 186..199 CDD:275378 6/12 (50%)
leucine-rich repeat 215..230 CDD:275378 5/18 (28%)
Ig 278..391 CDD:299845 24/120 (20%)
I-set 279..391 CDD:254352 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.