DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42709 and lrrc3b

DIOPT Version :9

Sequence 1:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001082985.1 Gene:lrrc3b / 100037364 ZFINID:ZDB-GENE-070410-55 Length:258 Species:Danio rerio


Alignment Length:160 Identity:44/160 - (27%)
Similarity:71/160 - (44%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SCPRNCLCLEDFK-----FVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEI 151
            :||:.|.|.....     .|.|:.:.|..:|.|:|....::.|..|.|:.:....|..|.....:
Zfish    33 TCPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVPDRIFHGLRMLRRL 97

  Fly   152 NLNHNLISSIDKDVFQGSE-RLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNN------TITQR 209
            ||:||.:.::.:..|.|.| .|:.|.|:.||:|.:..|.||..|...::|  ||      .:.|.
Zfish    98 NLSHNAVETLGEGAFIGLEGSLEVLDLSYNRITSVHKDAFARLKARVVVD--NNPWHCDCALQQA 160

  Fly   210 LDGSFLNQPDLVEFSCVNCSWTELPEQTFQ 239
            |.|...|...::      |..:||.:|..|
Zfish   161 LGGMAHNHERVL------CRSSELRDQEGQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 16/56 (29%)
leucine-rich repeat 128..147 CDD:275380 5/18 (28%)
leucine-rich repeat 148..171 CDD:275380 7/23 (30%)
LRR_RI <150..225 CDD:238064 24/81 (30%)
LRR_8 171..254 CDD:290566 22/75 (29%)
leucine-rich repeat 172..195 CDD:275380 9/22 (41%)
leucine-rich repeat 196..219 CDD:275380 7/28 (25%)
leucine-rich repeat 220..243 CDD:275380 5/20 (25%)
leucine-rich repeat 244..268 CDD:275380
lrrc3bNP_001082985.1 LRRNT 34..72 CDD:214470 10/37 (27%)
LRR 1 69..90 4/20 (20%)
leucine-rich repeat 70..93 CDD:275378 5/22 (23%)
LRR_8 73..129 CDD:290566 16/55 (29%)
LRR 2 93..114 5/20 (25%)
LRR_4 94..132 CDD:289563 13/37 (35%)
leucine-rich repeat 94..118 CDD:275378 7/23 (30%)
LRR 3 118..139 8/20 (40%)
leucine-rich repeat 119..142 CDD:275378 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.