DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hip1 and tag-138

DIOPT Version :9

Sequence 1:NP_648597.2 Gene:Hip1 / 39450 FlyBaseID:FBgn0036309 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_493260.1 Gene:tag-138 / 184169 WormBaseID:WBGene00006484 Length:362 Species:Caenorhabditis elegans


Alignment Length:364 Identity:105/364 - (28%)
Similarity:168/364 - (46%) Gaps:58/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SVSKALNGLEAPLKTKHARSIIIMIHKAKEAKTFWMIISRQPLMQSRFTAWKFSHLLHKVLREGH 79
            :|.||:...|.|||.||..:|::..|..|.:..||..:.:..|.......|||..|:||:||:||
 Worm    13 AVQKAITKDETPLKPKHLETILLGTHTEKSSAIFWSSVKKIKLENHPVLTWKFCLLVHKLLRDGH 77

  Fly    80 ESAIRHSQSHKKMILEVGKMWGLLQD--DIGCCIQAYSKLLATKLNFHDKNRMFPGTLNISFTEL 142
            ....:.:..::|...::...|   :|  |.|.||.||.|||..::.||.|...|||.|.:|..:|
 Worm    78 PVVPKEAYRNEKRFTQLALHW---KDKRDYGPCIDAYCKLLHDRVIFHHKRPYFPGNLFVSPLQL 139

  Fly   143 FIAVDRDLNYCFQLCVEIFDYLEDIIALQLTIF-SSMEKYRMSSMTPQGQCRLAPIVCLIQDSNA 206
             ..:.|||:...:|..::...::.::|.|..:: .|....|....||||||.:.|::.:|.|:..
 Worm   140 -DTMGRDLSRMLRLTGDMMHQMDSLLAFQEKVYLLSNSSPRWDPNTPQGQCLMLPLISVIMDTWP 203

  Fly   207 LYDLSVRLMFKLHDGVPYDVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLITIPELPDSSPNFK 271
            .:...||:|:.||..|....:.|:|.||..:|.|.|.||......|||:..:.||..|..:|||.
 Worm   204 FFIYIVRMMYNLHSNVSPHELEGYRSRFQTIFEKTKQFYEECSKHQYFRCFVQIPTFPLHAPNFF 268

  Fly   272 SQNDFTSY--------------VPPV---------------------VHVPQEPDPVVEDLVDTN 301
            :|:|..||              |.|.                     .||.:|        .|.|
 Worm   269 TQSDLESYQTYLIGESKKLTETVTPAEEARTRIEHYENRLKEMHGEFQHVRRE--------ADEN 325

  Fly   302 NHELEAFSQAQQQLSMLEGIISEKEASI-----EELSFK 335
            ..|::   :.:.:|::.:...::.:|:|     :|.|.|
 Worm   326 REEVQ---RLRYELALRDASRTQNQAAIYDTPPDEFSIK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hip1NP_648597.2 ANTH 9..281 CDD:284961 91/282 (32%)
TMPIT 402..>504 CDD:285135
I_LWEQ 973..1120 CDD:279885
tag-138NP_493260.1 ANTH 13..276 CDD:336756 89/266 (33%)
GrpE <295..>333 CDD:383227 6/48 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159607
Domainoid 1 1.000 206 1.000 Domainoid score I1699
eggNOG 1 0.900 - - E1_KOG0980
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104219at2759
OrthoFinder 1 1.000 - - FOG0002012
OrthoInspector 1 1.000 - - otm14291
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1344
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.