DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps13D and LOC101883170

DIOPT Version :9

Sequence 1:NP_729825.2 Gene:Vps13D / 39448 FlyBaseID:FBgn0052113 Length:3919 Species:Drosophila melanogaster
Sequence 2:XP_005173849.2 Gene:LOC101883170 / 101883170 -ID:- Length:102 Species:Danio rerio


Alignment Length:106 Identity:27/106 - (25%)
Similarity:45/106 - (42%) Gaps:19/106 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 MLDKLSEIRQVKEVRQYRLKRPTCTVESNPIAWWKY--ATICHGFDFKKNEE-KWLMLKENLRYM 363
            |:|.|..|..:.:...||..||...|..|...||||  ::|......:.|:. .|..:|::.:.:
Zfish     1 MVDLLESIDCMVKNGPYRKFRPDVPVHRNARQWWKYGISSILEVHVRRFNQMWNWTNIKKHRQTL 65

  Fly   364 LLYKSIILNPNENLSAADK-----EFKAYIESDRKISDLTI 399
            ..||           ||.|     ..|...:::::|..||:
Zfish    66 KSYK-----------AAYKVKLTQSAKVREDTEKQIQVLTV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps13DNP_729825.2 Chorein_N 4..112 CDD:315323
VPS13 147..368 CDD:318996 19/68 (28%)
VPS13_mid_rpt <656..837 CDD:318998
VPS13 <2039..>2694 CDD:330393
SHR-BD 2836..3113 CDD:310922
VPS13 <3346..3802 CDD:330393
LOC101883170XP_005173849.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D4159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.