DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10973 and mRpL16

DIOPT Version :10

Sequence 1:NP_001034002.1 Gene:CG10973 / 39447 FlyBaseID:FBgn0036306 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_525041.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster


Alignment Length:77 Identity:16/77 - (20%)
Similarity:26/77 - (33%) Gaps:17/77 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SLYAISSLIR-NFQPGYDEFKRIKGIRSLIPCLKSTNTNVYVKTAFLIASLTSIEKSVRDDFVKE 226
            ||..:|.|.: :...|........|::...|.:|..|                :|:..|......
  Fly     3 SLKLVSQLFKQSLASGNMAIVNTAGLKYFAPPIKYQN----------------VEQPERPKLRVI 51

  Fly   227 EVFPVLVENLKP 238
            |..|.|..|::|
  Fly    52 ERQPQLPPNIRP 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10973NP_001034002.1 Fes1 13..94 CDD:462534
armadillo repeat 97..128 CDD:293788
armadillo repeat 136..172 CDD:293788 4/8 (50%)
armadillo repeat 178..209 CDD:293788 4/30 (13%)
mRpL16NP_525041.1 Ribosomal_L16 61..191 CDD:459733 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.