powered by:
Protein Alignment CG10984 and AgaP_AGAP005648
DIOPT Version :9
Sequence 1: | NP_729823.2 |
Gene: | CG10984 / 39446 |
FlyBaseID: | FBgn0036305 |
Length: | 658 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_315665.3 |
Gene: | AgaP_AGAP005648 / 1276332 |
VectorBaseID: | AGAP005648 |
Length: | 143 |
Species: | Anopheles gambiae |
Alignment Length: | 68 |
Identity: | 20/68 - (29%) |
Similarity: | 30/68 - (44%) |
Gaps: | 4/68 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GFNTGATQPRSNSNTPMSERQQMALLIQMTANSSTVQSQSLELLLVGLNFNLHHSSRTTLKKNEC 74
|.::|:...|| |...::||.:.||.| |:....|....:||..|.|.|:...:..|.....|
Mosquito 5 GASSGSAHSRS-SRDRINERGETALHI---ASKKGDQDSVKKLLEQGANPNVTDFAGWTPLHEAC 65
Fly 75 KKG 77
..|
Mosquito 66 NHG 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMIW |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.