DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10984 and AgaP_AGAP005648

DIOPT Version :9

Sequence 1:	NP_729823.2	Gene:	CG10984 / 39446	FlyBaseID:	FBgn0036305	Length:	658	Species:	Drosophila melanogaster
Sequence 2:	XP_315665.3	Gene:	AgaP_AGAP005648 / 1276332	VectorBaseID:	AGAP005648	Length:	143	Species:	Anopheles gambiae

Alignment Length:	68	Identity:	20/68 - (29%)
Similarity:	30/68 - (44%)	Gaps:	4/68 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 GFNTGATQPRSNSNTPMSERQQMALLIQMTANSSTVQSQSLELLLVGLNFNLHHSSRTTLKKNEC 74
            |.::|:...|| |...::||.:.||.|   |:....|....:||..|.|.|:...:..|.....|
Mosquito     5 GASSGSAHSRS-SRDRINERGETALHI---ASKKGDQDSVKKLLEQGANPNVTDFAGWTPLHEAC 65

  Fly    75 KKG 77
            ..|
Mosquito    66 NHG 68

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10984	NP_729823.2	None
AgaP_AGAP005648	XP_315665.3	ANK	18..131	CDD:238125	15/54 (28%)
		ANK repeat	23..54	CDD:293786	11/33 (33%)
		Ank_2	28..120	CDD:289560	12/44 (27%)
		ANK repeat	56..87	CDD:293786	3/13 (23%)
		ANK repeat	89..120	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_2CMIW
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900