DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klc and PEA2

DIOPT Version :9

Sequence 1:NP_001261780.1 Gene:Klc / 39445 FlyBaseID:FBgn0010235 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_011076.1 Gene:PEA2 / 856892 SGDID:S000000951 Length:420 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:41/187 - (21%)
Similarity:73/187 - (39%) Gaps:58/187 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AEVQKDNEKSDMLRKNIENIELGLSEAQVM-MALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDE 98
            |.:|:::..     |.:|.:|...|:.|:. ..||...:|..||   ....:.:|.:.|..|:|:
Yeast   234 AAIQEEDSS-----KKLEELETAFSDLQLAHNFLTKQFENDRAE---YVQDIEKLTRTNRELQDK 290

  Fly    99 LANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRH 163
            |.|.......:|:.:.:||:|.|.||                   |:.         ::.|..||
Yeast   291 LLNNHSNLSKTEKKLHELEQENKELE-------------------KAN---------NKLNSSRH 327

  Fly   164 NM------------SPTPPSQFANQTSGYEIPARLRTLHNLVIQY-----ASQGRYE 203
            |.            .|:.||...:.|||    :..|:|..:..::     ::|.:||
Yeast   328 NFGMSSPASSPVTWDPSSPSSVGSPTSG----SGSRSLSIMTSEFKKVLTSTQRKYE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KlcNP_001261780.1 TPR_12 185..258 CDD:315987 5/24 (21%)
TPR repeat 187..214 CDD:276809 5/22 (23%)
TPR_12 226..302 CDD:315987
TPR repeat 228..256 CDD:276809
TPR_12 269..344 CDD:315987
TPR repeat 270..298 CDD:276809
TPR_12 310..384 CDD:315987
TPR repeat 311..341 CDD:276809
TPR_12 353..469 CDD:315987
TPR repeat 354..381 CDD:276809
PEA2NP_011076.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2043
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.