DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klc and Pat1

DIOPT Version :9

Sequence 1:NP_001261780.1 Gene:Klc / 39445 FlyBaseID:FBgn0010235 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster


Alignment Length:535 Identity:114/535 - (21%)
Similarity:196/535 - (36%) Gaps:142/535 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEIITNTKTVLQGLEALRV--EHVSIMNGIAEVQKDNEKSDMLRKNIENIELG------LSEA-- 61
            ||...:..::: ||...|.  |.:..:|       |:...::....::.|:||      ||||  
  Fly   166 DEFSADIGSIV-GLPHRRATQEELDAIN-------DSGLEELSAVELQVIDLGLRLGSFLSEAGW 222

  Fly    62 -----QVMMALTSHLQNIEAEKHKLKTQV----RRLHQE-------------------NAWLRDE 98
                 .|:..|...|:::...||.|:.::    |.|:.|                   |.||...
  Fly   223 MQESITVLACLNVRLKDLPTHKHWLQFRLDCLQRLLYAESAHCNFKEAEKTYAELMGLNKWLNKS 287

  Fly    99 LANTQQKF---QASEQLVAQLEEEKKHL---EFMASVKKY-------DENQEQDDAC----DKSR 146
            :.|.....   |.|....|:.|.:..||   ..|..:|.|       |..::...||    |.:|
  Fly   288 VPNQLVAITYSQISAMYFARNEYKNSHLWSGLAMRFLKGYANPRTIIDVLRQAAKACVVKRDFAR 352

  Fly   147 TDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQ 211
            .:   .|........|....|| ..::.:....|..     .|.|:...:.|...|:.|:.:.:.
  Fly   353 AN---LLICQAVRRAREYFGPT-HQKYGDALLDYGF-----FLLNVDSVFQSVNIYKEALAVRRG 408

  Fly   212 -----------ALEDL-------ERTSG-----HDHPD----------------VATMLNILALV 237
                       |.|||       |.::|     .||.|                :|:...:.||:
  Fly   409 IFGNMNFHVAIAHEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHLMLASAKRVKALL 473

  Fly   238 YR------------DQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAE 290
            ..            :::...::..|.|.||.:..:..||.:...|....||..||....::::||
  Fly   474 LEEIALDKMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAE 538

  Fly   291 PLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQ-GKYDEVEKYYQRALDIYESKLGPDDP--- 351
            .:.|:|::|:.::||....:|...:.:||.|...| .||.:.|:.|.|::||.....|....   
  Fly   539 RMHKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYSGLE 603

  Fly   352 -------NVAKTKNNLAGCYLKQGRYTEA-EILYKQVLTR------AHEREFGAIDSKNKPIWQV 402
                   :|.:|.:|... |||.....|. ::|..|.||:      |.|.::...:.|.|.....
  Fly   604 YDYLGLCHVYETLHNFEK-YLKYAHKLENWQMLRGQNLTQNKSSYPAIEVDYSIEEVKAKYFSMC 667

  Fly   403 AEEREEHKFDNRENT 417
            |.::..|...:.|:|
  Fly   668 ASKKSAHPSVHEEDT 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KlcNP_001261780.1 TPR_12 185..258 CDD:315987 21/123 (17%)
TPR repeat 187..214 CDD:276809 6/37 (16%)
TPR_12 226..302 CDD:315987 20/103 (19%)
TPR repeat 228..256 CDD:276809 6/39 (15%)
TPR_12 269..344 CDD:315987 24/75 (32%)
TPR repeat 270..298 CDD:276809 9/27 (33%)
TPR_12 310..384 CDD:315987 24/91 (26%)
TPR repeat 311..341 CDD:276809 10/30 (33%)
TPR_12 353..469 CDD:315987 19/72 (26%)
TPR repeat 354..381 CDD:276809 8/27 (30%)
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142
TPR_12 478..547 CDD:290160 15/68 (22%)
TPR_12 516..590 CDD:290160 22/73 (30%)
TPR_10 517..553 CDD:290111 10/35 (29%)
TPR repeat 518..546 CDD:276809 9/27 (33%)
TPR repeat 559..590 CDD:276809 10/30 (33%)
TPR repeat 603..628 CDD:276809 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.