DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klc and KLC3

DIOPT Version :9

Sequence 1:NP_001261780.1 Gene:Klc / 39445 FlyBaseID:FBgn0010235 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_024307137.1 Gene:KLC3 / 147700 HGNCID:20717 Length:703 Species:Homo sapiens


Alignment Length:399 Identity:246/399 - (61%)
Similarity:304/399 - (76%) Gaps:16/399 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAE----------VQKDNEKSDMLRKNIENIELG 57
            ::|.:|::..|:.|:|||||||.||..:...:||          ::...||..::..::|.||||
Human    68 RLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELG 132

  Fly    58 LSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKH 122
            |.||||::||::|:..:||||.:|::|.|||.|||.|||:||..||::.:|||:.||||||||:|
Human   133 LGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRH 197

  Fly   123 LEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLR 187
            |||:..:::||...|...:....|.|.:..|||.||.|.:   .|......|.|..|||||||||
Human   198 LEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERK---GPEAAGAAAAQQGGYEIPARLR 259

  Fly   188 TLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLN 252
            ||||||||||.|||||||||||:||||||||:|||.||||||||||||||||||||||||.:||:
Human   260 TLHNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNILALVYRDQNKYKEATDLLH 324

  Fly   253 DALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNN 317
            |||.||.:|||..|||||||||||||||||||:|::|||||:|||||||||||.|||||||||||
Human   325 DALQIREQTLGPEHPAVAATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNN 389

  Fly   318 LALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLT 382
            ||||||||||:::||::|.|||.|||:..||.||||||||||||..||||.:|.:||.|||::| 
Human   390 LALLCQNQGKFEDVERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEIL- 453

  Fly   383 RAHEREFGA 391
              |:.:..|
Human   454 --HKEDLPA 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KlcNP_001261780.1 TPR_12 185..258 CDD:315987 64/72 (89%)
TPR repeat 187..214 CDD:276809 24/26 (92%)
TPR_12 226..302 CDD:315987 63/75 (84%)
TPR repeat 228..256 CDD:276809 24/27 (89%)
TPR_12 269..344 CDD:315987 62/74 (84%)
TPR repeat 270..298 CDD:276809 23/27 (85%)
TPR_12 310..384 CDD:315987 52/73 (71%)
TPR repeat 311..341 CDD:276809 23/29 (79%)
TPR_12 353..469 CDD:315987 22/39 (56%)
TPR repeat 354..381 CDD:276809 18/26 (69%)
KLC3XP_024307137.1 TPR_12 257..332 CDD:315987 66/74 (89%)
TPR repeat 259..286 CDD:276809 24/26 (92%)
TPR_12 298..374 CDD:315987 63/75 (84%)
TPR repeat 300..328 CDD:276809 24/27 (89%)
TPR_12 341..416 CDD:315987 62/74 (84%)
TPR repeat 342..370 CDD:276809 23/27 (85%)
TPR_12 382..453 CDD:315987 51/70 (73%)
TPR repeat 383..413 CDD:276809 23/29 (79%)
TPR repeat 426..453 CDD:276809 18/26 (69%)
SMC_N 72..>199 CDD:330553 60/126 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D238239at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45783
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.