DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp69D and F55H12.5

DIOPT Version :9

Sequence 1:NP_524048.2 Gene:Ptp69D / 39443 FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_492395.2 Gene:F55H12.5 / 172700 WormBaseID:WBGene00010136 Length:287 Species:Caenorhabditis elegans


Alignment Length:333 Identity:69/333 - (20%)
Similarity:131/333 - (39%) Gaps:99/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 FITS-GNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNR 922
            ||.| .|.|.|:||      :...||..:.::...|        |.|  ::.|:.:..||     
 Worm    42 FINSKTNSKSFEAG------VAEFYKETYLESPTFF--------NYF--KSPKDKNFSEN----- 85

  Fly   923 YPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYKERKKFICAQGPME-STIDDFWRMIWEQHLE 986
               :..||.|||   ::.|:   ||.:|::|.|.|. .::|.||.|.: |...||::::.....|
 Worm    86 ---VWLYDATRV---IVPGV---DYYHASWVDGLKP-NQYILAQAPRDASAAKDFFKLLEHVKAE 140

  Fly   987 IIVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTG--DYIERTLNVSKNKANVGEE 1049
            .:::....:|::.|..||:                    |:.||  |::...:          .:
 Worm   141 GLIVAEGADEFSSAITAKF--------------------EKGTGKNDFVSTAV----------IK 175

  Fly  1050 EDRRQITQYHYLTWKDFMAPEHPHGIIKFIRQINSVYSLQR--------GPILVHCSAGVGRTGT 1106
            |:...:....:..|.:      |...|    :||.:....|        ||:::.|..|..::|.
 Worm   176 ENGLHLKAIKFCRWAE------PLSAI----EINDMLEKSRKYLGCPLKGPLVIVCKDGAAKSGL 230

  Fly  1107 LVALDSLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMAS 1171
            :..:|:...:|              ::|.:.....::||..|:.....|  ||.:.|:.|:::..
 Worm   231 VAFIDTEADRL--------------MKHGKAKHTDTIKQIRFMRSNTFD--TFDSYDLGINSLIE 279

  Fly  1172 AIESLKRK 1179
            .....|:|
 Worm   280 LCNRYKKK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653
Ig 150..221 CDD:143165
fn3 237..321 CDD:278470
FN3 339..432 CDD:238020
FN3 439..535 CDD:238020
PTPc 892..1155 CDD:214550 52/273 (19%)
PTPc 920..1155 CDD:238006 46/245 (19%)
PHA02694 <1121..1206 CDD:177476 11/59 (19%)
PTPc 1186..1449 CDD:214550
PTPc 1216..1449 CDD:238006
F55H12.5NP_492395.2 PTPc 74..270 CDD:214550 53/268 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4228
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.