DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptp69D and egg-5

DIOPT Version :9

Sequence 1:NP_524048.2 Gene:Ptp69D / 39443 FlyBaseID:FBgn0014007 Length:1462 Species:Drosophila melanogaster
Sequence 2:NP_491316.1 Gene:egg-5 / 172007 WormBaseID:WBGene00020035 Length:753 Species:Caenorhabditis elegans


Alignment Length:394 Identity:97/394 - (24%)
Similarity:155/394 - (39%) Gaps:105/394 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   892 GFLREYEMLPNRFS--DRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVI 954
            |..|.:|:|.|..:  ..|...||..:..|:|  |.:...|.||:.|....|....|:|:||.:.
 Worm   407 GMERRFEILENSVNHIPFTHSASDNNQEKCRN--PRVHCRDSTRIALQFPRGQYLGDFIHANRIS 469

  Fly   955 GYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFD------- 1012
            |.....:||..|.||::|:||||||:|::.:..|||||:.:|  ..:|..|||:...|       
 Worm   470 GKPLFNEFIMTQAPMKNTVDDFWRMVWQEEVPYIVMLTSRKE--PERCEYYWPKSPSDPAVTVPG 532

  Fly  1013 ---TKQFG-----DILVKFAQERKTGD-----YIERTLNVSKNKANVGEEEDRRQITQYHYLTWK 1064
               .:.||     |.|.:....|..|.     ::|.......|.:|:                  
 Worm   533 GLRIENFGVYQAPDPLFRVTHLRLIGPDREERHVEHWQGDVNNSSNM------------------ 579

  Fly  1065 DFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVS--IYN 1127
                 ..|..|::.:|..:.       |:::|...||.|...|||.:..|..|....:..  :..
 Worm   580 -----YSPLNILRLLRNASK-------PVVIHDHLGVSRAACLVAAEIAICSLLRGPTYKYPVQR 632

  Fly  1128 TVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGKCKLEVEFE 1192
            .|..||.:|.|.:::..||||::|.:    .|...|:        |.|.|        :|:|::|
 Worm   633 AVQFLRQRRPFSIETPMQYIFVHRLV----AFFFRDV--------IGSAK--------ELDVDYE 677

  Fly  1193 KLLATADE----------------ISKSCS------VGENEENNMKNRSQEIIPYDRNRV----- 1230
            :.|....|                :|....      ||..|..|.:..:.:.:....|:|     
 Worm   678 RWLQERSERMFLDDLAAPIPGYRLLSPRADPDIVRMVGRPERPNYRREAPDCVGEMPNKVAAVDG 742

  Fly  1231 ILTP 1234
            ||:|
 Worm   743 ILSP 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptp69DNP_524048.2 IG_like 139..233 CDD:214653
Ig 150..221 CDD:143165
fn3 237..321 CDD:278470
FN3 339..432 CDD:238020
FN3 439..535 CDD:238020
PTPc 892..1155 CDD:214550 77/286 (27%)
PTPc 920..1155 CDD:238006 68/256 (27%)
PHA02694 <1121..1206 CDD:177476 21/102 (21%)
PTPc 1186..1449 CDD:214550 15/76 (20%)
PTPc 1216..1449 CDD:238006 5/24 (21%)
egg-5NP_491316.1 PTPc 407..660 CDD:214550 77/290 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.