DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and TGIF2LX

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:242 Identity:54/242 - (22%)
Similarity:84/242 - (34%) Gaps:82/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE 291
            |:.|...|:...|:.|:.:|:...||::.||.||:..|.::|.|:|.||.|||||:..:  |..:
Human    53 RKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPD--MLQQ 115

  Fly   292 PRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESR 356
            .||                          |..:|....||....          ...::|.|...
Human   116 RRN--------------------------DPIIGHKTGKDAHAT----------HLQSTEASVPA 144

  Fly   357 PGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQQAQQNS 421
            ...|:|.    |...|:|  ..||            |.|             |:.::.|...:::
Human   145 KSGPSGP----DNVQSLP--LWPL------------PKG-------------QMSREKQPDPESA 178

  Fly   422 LQTAVGGTAKPRIWSLADMASKDSKDSSSGAKDNHPEL--PPAHPGF 466
            ....:.|.|:|:           .|...|....:.|||  |..|..|
Human   179 PSQKLTGIAQPK-----------KKVKVSVTSPSSPELVSPEEHADF 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 17/38 (45%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 2/4 (50%)
Homeobox_KN 68..107 CDD:283551 17/38 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 24/135 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.