DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and CUP9

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_015148.1 Gene:CUP9 / 855926 SGDID:S000006098 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:58/208 - (27%)
Similarity:77/208 - (37%) Gaps:38/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PGPHSSAPGGAPAPGAGNPPNRCCDTGRTIYTDPVSGQTI-CSCQYDMLNYQRLAAAGGVPLGVY 160
            |..||.|   .||..:|........|..|:.|...|...: ...||                   
Yeast    67 PQHHSIA---YPAINSGGTSTTATPTASTVETSKTSSSAMDTQSQY------------------- 109

  Fly   161 PEGMSAYLSGIAADQPPFYAN-PAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLN 224
              |.|......:.|..|.|.: |....:.:...|||.          |:..|:.:..:......|
Yeast   110 --GSSKKSKSASDDAKPCYKSAPIYEIINKEKDAGAQ----------YNRPFSDFVESKSRRKQN 162

  Fly   225 GARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT 289
            ..||.|..:||...|..||..|..|||||:.||..|.|.|.:|..|:|.||.|.|||....:..|
Yeast   163 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIFSDYYT 227

  Fly   290 WEPRNRVDDDDAN 302
            ..  |.:.:|:||
Yeast   228 LV--NSIPNDNAN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 20/38 (53%)
CUP9NP_015148.1 Homeobox_KN 180..219 CDD:399131 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.