DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and TOS8

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_011419.1 Gene:TOS8 / 852783 SGDID:S000003064 Length:276 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:65/230 - (28%)
Similarity:82/230 - (35%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SPCGPSAGLPALSLVGAPPPGPHSSAPGG--------APAPGAGNPPNRCCDTGRTIYTDPVSGQ 134
            ||..|   :|..|.|....|.|..|....        ...|...|.......||...|...|.|.
Yeast    56 SPVNP---VPVSSPVFFIGPSPQRSIQNHNAIMTQNIRQYPVIYNNNREVISTGERNYIITVGGP 117

  Fly   135 TICSCQ--YDML---NY---QRLAAAGGVPLGVYPEGMSAYLSGIAADQPPFYANPAGI------ 185
            .:.|.|  |:.:   |:   ||||..       :|...|..:.|        |.||..|      
Yeast   118 PVTSSQPEYEHISTPNFYQEQRLAQP-------HPVNESMMIGG--------YTNPQPISISRGK 167

  Fly   186 ----DLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRETTSTLKAWLNEH 246
                ::..|.|.|::               .||.........:| :|.|..:.|.|.|..||:||
Yeast   168 MLSGNISTNSVRGSN---------------NGYSAKEKKHKAHG-KRSNLPKATVSILNKWLHEH 216

  Fly   247 KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 281
            ..|||||..||..|...|.:|..|:|.||.|||||
Yeast   217 VNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 21/38 (55%)
TOS8NP_011419.1 Homeobox_KN 212..251 CDD:399131 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.