DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and HMRA2

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_010020.1 Gene:HMRA2 / 850458 SGDID:S000000692 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:27/87 - (31%)
Similarity:40/87 - (45%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GYPFNSYGMDLNGARRK-----NATRETTSTLKAWLNEHKKNPY-PTKG-EKIMLAIITKMTLTQ 270
            |..||....|:.....|     ..|:|....|::|..::.:||| .||| |.:|..  |.::..|
Yeast    22 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN--TSLSRIQ 84

  Fly   271 VSTWFANARRRLKKENKMTWEP 292
            :..|.:|.||   ||..:|..|
Yeast    85 IKNWVSNRRR---KEKTITIAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 14/40 (35%)
HMRA2NP_010020.1 HOX 44..97 CDD:197696 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.