DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and BLH6

DIOPT Version :10

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_195187.1 Gene:BLH6 / 829613 AraportID:AT4G34610 Length:532 Species:Arabidopsis thaliana


Alignment Length:146 Identity:45/146 - (30%)
Similarity:65/146 - (44%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVDDDDANI 303
            |:|||.||..:|||...:|||||..|.::..|||.||.|||.||       |:|  .|::.....
plant   329 LRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARVRL-------WKP--MVEEIYKEE 384

  Fly   304 DDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPGSPNGSPDLYD 368
            ..::|.|:...:.....:.|..:.||:||:.......| :|...:.  :.|...|...||    .
plant   385 FTENDSNSSSENTPKMSEIGPVAADDEDRAREFSQDQT-KPDHGHG--YGEETRGMVQGS----H 442

  Fly   369 RPGSMPPGAHPLFHPA 384
            ..|.......|.:|.|
plant   443 MDGRRFMAVEPTYHVA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 243..281 CDD:428673 20/37 (54%)
BLH6NP_195187.1 POX 135..269 CDD:214728
Homeobox_KN 333..371 CDD:428673 20/37 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.