DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and ATH1

DIOPT Version :10

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_195024.1 Gene:ATH1 / 829435 AraportID:AT4G32980 Length:473 Species:Arabidopsis thaliana


Alignment Length:100 Identity:31/100 - (31%)
Similarity:46/100 - (46%) Gaps:29/100 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SMYHPYDAAFAGYPFNSYGMDLNGARRKN---------ATRETTSTLKAWLNEHKKNPYPTKGEK 257
            ||:|.:..             |...:|||         ...::.|.|:.|:.::..:|||...||
plant   354 SMFHQHCL-------------LQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEK 405

  Fly   258 IMLAIITKMTLTQVSTWFANARRRLKKENKMTWEP 292
            .:|||.:.:|.:|||.||.|||.||       |:|
plant   406 HLLAIRSGLTRSQVSNWFINARVRL-------WKP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 243..281 CDD:428673 17/37 (46%)
ATH1NP_195024.1 POX 196..334 CDD:214728
Homeobox_KN 391..429 CDD:428673 17/37 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.