DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and mkxa

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001092203.2 Gene:mkxa / 799136 ZFINID:ZDB-GENE-080513-1 Length:349 Species:Danio rerio


Alignment Length:209 Identity:59/209 - (28%)
Similarity:90/209 - (43%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMT 289
            ::.|.::....||.||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::
Zfish    70 KRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLS 134

  Fly   290 WEPRNR--------------VDDDDANIDDDDDKNTED---------NDLLDAKDSGVGS----- 326
            |..|.:              |..||:..||.|......         ..::..:..|:|:     
Zfish   135 WALRIKLYNKYVQGNAERLSVSSDDSCSDDADPATRAQVGEFSKPMYQSVIKKEGGGMGAGLRAA 199

  Fly   327 -----TDD-----KDRSGRLGDMMTDRPGE---SNNSEWSESRPGSPNGSPDLYDR----PGSMP 374
                 .||     |.:|..|...:.|....   :|....:..|..|.:.|.:.||.    |.|..
Zfish   200 SDASLADDYVSPPKYKSSLLHRYLNDSLRHVMGANGVMDARKRNHSGSFSSNEYDEDLLSPSSSE 264

  Fly   375 PGAHPLFHPAALHH 388
            ..|:.::....:.|
Zfish   265 AEANFIYRTETVEH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 26/38 (68%)
mkxaNP_001092203.2 Homeobox_KN 84..123 CDD:283551 26/38 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.