Sequence 1: | NP_001261778.1 | Gene: | mirr / 39441 | FlyBaseID: | FBgn0014343 | Length: | 682 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092203.2 | Gene: | mkxa / 799136 | ZFINID: | ZDB-GENE-080513-1 | Length: | 349 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 59/209 - (28%) |
---|---|---|---|
Similarity: | 90/209 - (43%) | Gaps: | 48/209 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 RKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMT 289
Fly 290 WEPRNR--------------VDDDDANIDDDDDKNTED---------NDLLDAKDSGVGS----- 326
Fly 327 -----TDD-----KDRSGRLGDMMTDRPGE---SNNSEWSESRPGSPNGSPDLYDR----PGSMP 374
Fly 375 PGAHPLFHPAALHH 388 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mirr | NP_001261778.1 | Homeobox_KN | 242..281 | CDD:283551 | 26/38 (68%) |
mkxa | NP_001092203.2 | Homeobox_KN | 84..123 | CDD:283551 | 26/38 (68%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |